KEGG   Pogona vitticeps (central bearded dragon): 110070404Help
Entry
110070404         CDS       T05000                                 

Definition
(RefSeq) bone morphogenetic protein receptor type-1A-like
  KO
K04673  bone morphogenetic protein receptor type-1A [EC:2.7.11.30]
Organism
pvt  Pogona vitticeps (central bearded dragon)
Pathway
pvt04060  Cytokine-cytokine receptor interaction
pvt04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    110070404
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110070404
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pvt01001]
    110070404
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pvt04090]
    110070404
Enzymes [BR:pvt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     110070404
Protein kinases [BR:pvt01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   110070404
CD molecules [BR:pvt04090]
 Proteins
  110070404
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr TGF_beta_GS Pkinase_fungal FTA2 Haspin_kinase APH
Motif
Other DBs
NCBI-GeneID: 110070404
NCBI-ProteinID: XP_020633734
Position
Unknown
AA seq 347 aa AA seqDB search
MAHYCKWVAKRQCYNRDLEQDEAFIPARESLQDLIDQSQNSGGGSGLPLLVQRTIAKQIQ
FVQQVGKGRYGEVWMGKWQGEKVAVKVFFTTEEASWLRETEIYQTVHMRHENILGFIAAD
IKGSGSWTHLYLITDYHENGSLYDFLKCTTLDNRALLKLAYSAACGLCHLHTEIYGTQGK
PAIAHRDLKSKNILIKRNGTCCIADLGLAVKFNSDTNEVDVPLNTRVGTKRYMAPEVLDE
TLNKNHFQSYIMADIYSFGLIIWEMARRCVTGGIVEDYQLPYYDMVPSDPSYEDMREVVC
VKHLRPVVSNRWNGEEPPFSAHKKPPSLIAQKTRPPLQGSPVEPLNE
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggcgcattattgtaaatgggtagcaaaaaggcagtgttataatcgtgatctggagcaa
gatgaagcttttattcccgctagggagtcacttcaggatcttattgatcagtcacagaat
tctggaggtggttcaggacttccgttgctggtacagcgaactattgccaaacaaattcag
ttcgtacagcaggttgggaaggggcgatacggtgaagtgtggatgggtaaatggcagggt
gaaaaggtggcagtgaaagtatttttcaccactgaagaagccagctggcttcgagaaact
gagatttaccaaacagttcacatgcggcatgagaatatacttgggtttatagcagcagat
attaaaggctcaggctcctggacccacctttacttaattacagattatcatgaaaatgga
tcattgtatgatttcctgaagtgtaccactctagacaacagagctctgctcaaactggca
tactccgctgcatgtggtctctgccatttgcacacagaaatatatgggacacaaggaaag
cctgctattgctcacagagacttgaagagtaaaaatatcttgataaagagaaacgggact
tgctgtattgctgatttggggcttgctgtcaaatttaacagtgatactaatgaggttgat
gttccattgaatacaagagtgggaacaaagcgttacatggctccagaagtcctagatgaa
acactgaataaaaatcatttccagtcatatatcatggctgatatctacagttttggcttg
ataatttgggaaatggctcgacgttgtgttacaggaggtattgttgaagattaccagcta
ccctattacgacatggtgcccagtgatccttcatatgaagatatgagggaagtggtatgt
gttaagcacctgcgcccagtagtatctaatagatggaatggtgaggaacctcccttctct
gcccataaaaagccccctagcctcatcgctcagaagacacgacctcccttgcaaggcagc
ccagtcgagccactcaatgagtag

DBGET integrated database retrieval system