KEGG   Pogona vitticeps (central bearded dragon): 110070448Help
Entry
110070448         CDS       T05000                                 

Gene name
ESPL1
Definition
(RefSeq) separin isoform X1
  KO
K02365  separase [EC:3.4.22.49]
Organism
pvt  Pogona vitticeps (central bearded dragon)
Pathway
pvt04110  Cell cycle
pvt04114  Oocyte meiosis
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110070448 (ESPL1)
   04114 Oocyte meiosis
    110070448 (ESPL1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:pvt01002]
    110070448 (ESPL1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pvt03036]
    110070448 (ESPL1)
Enzymes [BR:pvt01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.49  separase
     110070448 (ESPL1)
Peptidases [BR:pvt01002]
 Cysteine Peptidases
  Family C50: separase family
   110070448 (ESPL1)
Chromosome and associated proteins [BR:pvt03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   Separase
    110070448 (ESPL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C50 CHAT
Motif
Other DBs
NCBI-GeneID: 110070448
NCBI-ProteinID: XP_020633796
Position
Unknown
AA seq 2222 aa AA seqDB search
MKLLKGLDFVAQTSTPEETLALLSELKEYLICGTQNADSASQASKRSTVCDRILRACIQR
FGAGLDCPVHCRNLQALAEMAYHGYVAARSQYVPLYLERLLYHVLRGVAAWGPSDGCLKF
ATLLYAELSKYQPPQVPADDYISIVKSAFSLLWKSADVVAKTDKTPAEFRAMLSTYLRAV
RFLVLLEHNTFVPFSQEPPFFTSTVARHASATAVLFEGQRSPLSKEEACFLSDQFSHHLV
AALLERTDEEEALAFQDCLCVFELTLIRSRYLCKSGCFRESKEILQQCSGYLRKSIDLKH
CFSSPLEVLSAGVGVNQVLMLSEGLVDLFFIKAAEALKTSSDAEEPLLRLLAESCQMLIT
PLYGHVRKSQWRPFNSQETLGICVFMENYFRLLKKLTGMVSSDNVKQKQALKKLMYNYFQ
LFTTIVYDSLQTLQRPECPGLPQLLVSLQTTVTLMLDMLEDLNEKEEAEHLDLSAYCVSR
LAYSFYSHKMYTESNSIAELFCRWLAKEELSKCPGILTEKLQNCFKLQVENYRKLSLLEE
ALQAVVFWLASCHGKITELMAEPISYWVKVKMDASKNGAQDLRLKTLKEGLEGYSIDAEI
LMKVLLEELKAYKTVRGDTGQERFNVICDLLDLCPEGSAWFHQRAVILVELAQVLCYHDY
SEHTECSALDSVREALRLLDAVPKTPQNEAELQDDKAQALLWLYICTIEDKMCESIKQEQ
RTRNAQGQKDARDLESFETNDLGYENKTHDDKFLYLGIAFNLSADSAQSKCLDDALSLWK
DLLSKGRIPAVRSIEQTTASLHIMAALYRMMGKPLQAMESYFLITNLSGALKDSVGKTNA
LCQIVKLLLQLECPSYAEATLKEAESCLQDVDRNHDSCLLTNLTLAVLRSKLCLANNKME
EGLLLLVETLQNPALQKSSKVWYLLRASSLQLTATYLGLPPSVLPLVLRQKLYAQGWKTP
EMALSDAHRLYRSILLNFSLISSSDTSTKDVPEHQFVDHGDNIVQKWQVLADMFVCSESF
VTLLGKMEIVSEAKAFCLEALKISMKLQSIRWCARFLVLKSRLELQRSDLELCRSDLEQV
LFLLESSTVFETKEEKSNAKIKPKKGRSTGRKNPESHSVEPSEEEAPFLREVPLEFIDTV
SVQKENPLTTSPALKPKLKKTLSILSHPETCPCSLCSDVVLSAVCLCWLVTSAERELAFG
NKAEGLGLLETGLQRCTRVALRVSNMVAGISQGKSKRSGARHQPTVGFLDPLVAHIYVTL
AKQSLSVNRLEKKLWKLLESGLSFTSSKGSRLPGLEYQRAQMLLAKAVAAISVLASRHDG
HAERIFSPAWSWKSPLFLQGEEETKPAATTTEATLDGFLPQAPKRRTRRLPGEAPKAKPK
RTQGTKPLPVLRPHDAFALADSDSEAPPIILRPPVEHCTPAQKSLPSYKMSGSSAAKQSR
ARRAPFVVFEDASPKPNKELPKAPKVTRRMKSRIKALFSNDSDSEDPPEAKPVPQLPAAK
EPTIIPRRTGQRMASGQKLSKGSLAKVEGCGGSSSEDCSQVGKAKPRPGRPCTRRAGRRG
RKPEGIQEGPYEETMGKVQDEQGRGGEEEEEKELLRTIEEGLEASFEIFRGSDEDIKECE
RQANTEDDQEVLRRDASGDCPVEVFQAADNRPSEDPFDLSSLASSLDTPATIADLLSTNS
IYDTLQAAFHLVSHYPSGTLYSRLCQLMALCIGSRDPTATAYLVSESVAVTLRHQIMTVI
HRKLNKMRKASVVSACRQLEALSLQEGKADSRAQHLSELQSLFEFSYPTSTELGTETFKK
QLRQIPHGVTVCILTLVSIQPDTVGDLLLLTRLEKDATPVTIQIQSVHSKIPLSAALGEF
DAILQKQKEISNCTEKEEWWNGRIALDNRMKALIESLERDVLGCWRGALLPAGEDPSLAE
EALCLQTRLEECGCQEVDLALLKVMLTGSHLLTPEDVQCLVLGLNSSEPEKAQKLLQEAV
DKVGERSAPASSGHVVLVLDKHLQKLPWENIPCLRGQSVTRLPSLRFLLSYSLAKKYQEE
TVLHQGVNSSNTFYVLNPHTNLPGTEKIFRDWFQSEPGWSGVVGEVPGADQVPLALEERD
LYIYAGHGAGARFVDSILKVDCRAVALLFGCSSAALAVQGNLEGNGAILKFLMAGCPLVL
GNLWDVTDRDIDRYMEALLKNWLKAGSGAPLLQYVIQSRQAPRLKYMIGAAPIAYGLPVF
LR
NT seq 6669 nt NT seq  +upstreamnt  +downstreamnt
atgaagctccttaaaggtctagattttgtggcacagaccagcactcctgaagaaactctg
gctttgctgtcagagctgaaggaatatctcatctgtgggacacaaaatgctgatagtgca
agccaagcctccaaacggagcacagtatgtgatcggatcctgcgagcttgcatccagaga
tttggggcaggtttggactgccctgttcactgcagaaacctccaggccttagctgagatg
gcttatcatggctacgttgctgcaaggtcgcagtatgttcccctctacttggagagattg
ctttaccatgtgctgaggggtgtcgctgcttggggcccatccgatggctgcctcaaattt
gccactctcctgtatgctgaattatcaaagtatcagccgcctcaggttccagctgatgac
tacatatctattgtcaaaagtgcctttagcttgctctggaagagtgcggatgttgtggcc
aagacggacaagactcctgcagagttcagggctatgctgtccacctatttgcgagcagtc
cgttttttggtccttctggagcacaacacctttgtccccttttcccaggagcctccgttc
tttacctccacggtcgctcggcatgcttcggccaccgctgttctgtttgagggccagcga
agcccactgagcaaggaagaggcctgtttcctcagcgaccagttctcccaccatcttgtt
gcagccctgctggaaagaacagatgaggaagaggctctggccttccaggattgcctttgt
gtctttgagctcaccctcattaggtcccgttacctttgcaaaagtggctgcttcagagag
agcaaggaaatactgcagcaatgcagtggctacttgagaaaatccattgacctgaagcat
tgctttagtagccccttagaggttctctcagctggagttggagtgaaccaggtattgatg
ctcagcgagggtttggtagaccttttctttatcaaggccgctgaggctttaaagacttcg
tcagatgcggaagagcccttgcttagactgctggctgaaagctgccaaatgcttataacc
cccttgtatggacatgtgagaaaaagtcaatggaggcccttcaattcacaagagactctg
gggatctgtgtctttatggaaaattacttcaggttgctcaaaaaacttacaggcatggtt
tcatcagacaatgtgaaacagaaacaagctctgaagaaactgatgtataattatttccaa
ttgttcacaacaatagtatacgattctcttcagactctacagagacccgagtgtcctggg
ttgccacagctgttggtgtctcttcaaacaaccgttaccttgatgctggatatgctagaa
gatcttaatgagaaggaggaggctgaacacctggatctctcagcctactgtgtgtcccgg
ctagcatatagcttctactctcataagatgtatacggaatctaactccatagcagagctc
ttctgcagatggttggccaaagaagagctttccaaatgtccaggcatacttacggaaaag
ttacagaattgttttaagctgcaagtggaaaactacaggaagttaagcttgttagaggaa
gctttgcaggcggttgttttctggctggcctcttgtcatggcaagatcacagaactgatg
gcagagccaatatcctactgggtgaaagtcaagatggatgccagcaaaaatggggcacaa
gatctgaggctgaagactttgaaggaaggcctagaaggctatagcatagatgctgagatc
ctcatgaaggtgctcttggaagaactgaaggcctataagactgtccggggagacactggc
caagaacgcttcaatgtgatttgtgacctgcttgatctctgtccggaaggcagcgcttgg
ttccatcagcgagctgtgatcctagtggaactggcccaagtgctgtgttatcatgactac
agtgagcatacagaatgttctgctctggactcggtgcgtgaagccctgcggctgttggat
gctgtcccaaagactccccagaatgaagcagagctccaagacgacaaggcccaagctttg
ctctggctttatatctgcacaattgaggacaaaatgtgtgagagcatcaagcaagaacag
aggaccagaaatgctcagggacaaaaagatgcaagagatcttgaaagctttgagaccaat
gatcttggatatgaaaacaagacccacgatgacaagttcctgtaccttggcattgccttt
aacctctctgcagattctgcgcagtccaagtgtttggatgatgcccttagcttgtggaag
gatctcctgtccaagggtaggatcccagctgtgcgtagcattgaacagacaacagcatct
ctgcacatcatggctgctttgtacaggatgatgggaaagccactgcaagccatggagagc
tatttcctcatcacaaatctttctggagccctcaaagactcagttgggaagaccaatgcc
ttgtgccaaattgtcaagttacttctccagctggaatgtcctagttatgcagaggccacc
ttaaaggaggctgaatcctgcctgcaagacgtggacagaaatcacgactcctgcctgctg
acgaatctaacgctggcggtgctccgtagcaagctgtgtttagcaaacaacaagatggaa
gaaggtctcctcctccttgtagaaactctacaaaacccagctttgcagaagtcctccaag
gtctggtatctgctccgagccagctctcttcaattaacagctacatatcttggcctacct
ccttctgtgctcccattggtactcaggcaaaaactctatgctcaaggatggaaaactcca
gaaatggctctgagtgatgctcacagactctaccgcagcatccttttgaacttctcactg
atcagtagtagtgacacgtccacaaaagatgttccagaacatcagtttgtagatcatggt
gacaacattgtgcagaagtggcaagtgctggctgacatgtttgtatgttctgagagcttt
gtcaccctccttggcaagatggagattgtaagcgaagcaaaagccttctgcttggaagca
cttaaaatctccatgaagctgcagtcaattcgatggtgtgctcgctttctagttttgaag
agcagactggaactgcagcgcagtgacctcgagctttgtcgttcagaccttgagcaggtc
ctgtttcttcttgaatcaagcacagtgtttgaaacaaaggaagaaaaaagcaatgcgaag
atcaagccaaagaaaggccgatccacaggcaggaagaatcccgaaagccactctgtggag
ccttcagaggaagaggcgcctttcttgagagaagtcccgcttgagttcattgacacagtc
tccgtgcagaaggagaaccctttgaccacctcgccagcgctgaagccaaagttgaagaaa
accctcagtatcctgagccacccggaaacatgtccttgttctctctgctctgacgtggtt
ctctccgccgtctgcctgtgctggctggtgacctctgcggaaagggaactggcctttggg
aacaaggccgaagggttgggcctccttgagaccggcctgcaacggtgtacgagagtggct
ctgcgcgtctccaacatggtggcaggcatctctcaaggcaaaagcaagagaagtggggcc
cggcatcagcccaccgttgggtttcttgaccctctggtagcccatatttatgtgactttg
gcaaaacaaagcctgagcgtcaataggttggaaaagaagctctggaagctcctggagagc
ggcttaagcttcacgtcctccaaggggtctcggctgcccggactggaatatcaacgagcc
cagatgttgcttgccaaagctgtagctgccatctctgtcttagcctcccgtcacgatggc
cacgcagaaagaatattttcccctgcctggtcctggaagtctcctttgtttctccaggga
gaggaagaaactaaaccagcagccaccacaactgaggcaactttagatggatttcttcct
caggctccaaaacgcagaacgcggaggctgccgggagaggcccctaaagcaaagccgaag
agaacccaaggaaccaaacccctgccggtcctccgaccccacgatgcgtttgccctggct
gactccgactcggaggctcctccgatcatccttcgcccccctgtggaacactgtacccca
gcccagaaatccttaccatcctacaagatgagcggctcttcagccgccaagcagagccgt
gcccgccgggctccgtttgtagtttttgaggacgcttctcccaagccgaacaaggagctt
ccgaaggcccccaaagtgacgaggagaatgaagtctcgcatcaaggccctcttcagtaat
gacagtgacagtgaagaccctccagaggccaaaccagtgccacagctccctgctgccaag
gagcccacgatcatccctcgcaggacggggcagaggatggcatctggccaaaagctatct
aagggaagccttgctaaagtggaaggatgtggtggtagctcctcagaggactgctctcag
gtggggaaggcaaagccccgtcctggaaggccctgcaccaggagagctggtcgacgagga
aggaaaccagaaggaatccaagaagggccttatgaggagacaatgggcaaagttcaggat
gaacagggacgaggaggagaagaagaagaagaaaaggagctgctgaggaccattgaagag
gggcttgaggccagttttgaaatcttccggggttctgatgaagatattaaagagtgtgaa
aggcaggcaaatacagaagatgaccaagaggttctccggcgagatgccagcggtgattgt
cccgtggaggttttccaggctgcagacaacaggccctcagaggaccctttcgacctgtct
tccctggcctcttccttggatacacctgccactattgcagacttgctgtccaccaactca
atctatgacacgttgcaagccgccttccacttagtcagccattacccttcgggaaccctc
tacagccgtctctgccagctcatggccctgtgtattgggagccgggacccaacagctaca
gcctacctggtttctgagtcagtggctgtcactcttcgtcatcagataatgactgtcatt
cacaggaaactcaacaaaatgagaaaggcatctgtggtcagtgcctgcagacagttggaa
gctcttagcctgcaagaaggaaaagcggattctcgggcgcagcacctctcagagctccag
agcctctttgaattcagctaccctacttcaaccgagctggggacagagaccttcaagaag
cagctacgacaaatcccccatggagtgacagtgtgcatactgaccctggtgagcatccag
ccagacactgttggggatctcctcctgctgacccgcctggaaaaggatgccacccctgtg
acaatccagatacagagtgtccattccaagattcccttaagcgcagcgctcggcgagttt
gatgctatcttgcagaagcaaaaagagatctctaactgcacggagaaggaggagtggtgg
aatgggcggattgctctggataacagaatgaaggctttgattgagtcgctggagagagac
gtgctcggttgctggaggggtgccctgctcccagccggcgaggatccgagtctggcagag
gaagccctctgcttgcagacacgtcttgaggagtgtggctgtcaggaagtggatctggca
ctactcaaggtcatgctgactgggtcacatctcctgaccccagaagatgtgcagtgtttg
gtactggggctgaactcctcagaacctgagaaagcccaaaaacttctgcaggaggcagtg
gacaaagtgggagaacgttctgctccggcatctagcggccatgtggttctcgtgctggac
aaacatttgcagaagcttccctgggaaaacattccatgcttgcgaggccagtccgtgacc
cggttgccatctttgcgcttcctgcttagctactcacttgccaaaaagtatcaggaagag
actgttctccaccagggtgtcaacagcagcaacaccttctacgttttaaatccacacaca
aacctccctggaacagagaagattttcagagattggtttcagagtgagcctggatggtca
ggagttgtgggagaggttcctggtgcagaccaagtcccgctggccctggaagaacgcgat
ctctacatctatgctgggcatggggcaggtgcacgcttcgtggactccatcctgaaggtg
gactgcagggctgtggctcttctcttcggctgcagcagtgctgccctggccgtgcaaggc
aatctggaaggaaatggggctatcctcaagtttctcatggcagggtgtcccctggtgctg
ggtaacctctgggatgtaactgaccgagacattgatcgttacatggaggcgctcctgaag
aactggctcaaggcaggatcaggagcccctctgctccagtatgtcatacagtcccgtcaa
gcccccagactcaaatacatgataggtgctgctcccatagcctatggcctaccagtattt
ctgcggtag

DBGET integrated database retrieval system