KEGG   Pogona vitticeps (central bearded dragon): 110070583Help
Entry
110070583         CDS       T05000                                 

Definition
(RefSeq) guanylate cyclase soluble subunit beta-2-like
  KO
K12319  guanylate cyclase soluble subunit beta [EC:4.6.1.2]
Organism
pvt  Pogona vitticeps (central bearded dragon)
Pathway
pvt00230  Purine metabolism
pvt01100  Metabolic pathways
pvt04270  Vascular smooth muscle contraction
pvt04540  Gap junction
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    110070583
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    110070583
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    110070583
Enzymes [BR:pvt01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     110070583
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc HNOB HNOBA
Motif
Other DBs
NCBI-GeneID: 110070583
NCBI-ProteinID: XP_020633925
Position
Unknown
AA seq 783 aa AA seqDB search
MYGFINTCLKSLVVEKYGEETWEKLRAQTGVQDTFLTFEVYGDDITMQLIDKACKILDVP
PDMVLKQFGEYFFEFCKRSGYDHMLRTLGGNLYEFIENLDALHSYLSLSYQEMNAPSFRV
EKNEDGSMHLHYYSDRRGLCHIVPGIIGAAALDFFNIETSMEIVNQTEEEERTGKKEHII
FLVTQKPLYPCKRKNKFSSSSSHLSSSGMQVEKQLKKEEIDRAMNKIRDKANVLSSCPVR
KSHWETIRGIVTIGKGRLLRAFNPVYPKTLWIDPKTFCNGLPFHIVFDEELKVKQAGVSI
QKIVPGLQTMGIRLNQYFSIVRPEVKFTISSVQKFINSQFVFRTKREMMPESWQQRPMLE
LRGQMIWMESVQCMLYLCSPLLRTLHELEERHMHIADIAPHDVTRDLILLNQQRLAEMEL
SNQLERKKEELRILSKHLEEEKKKTETLLYAMLPKHVANQLKEGKRVEAGEFKECTILFS
DVVTFTNICAQCEPIQIVLLLNAMYLRFDRLTTVHDVYKVETIGDAYMVVGGVPVPVSTH
AERVANFALGMIIAAKDIKNPVSGNPIQIRVGIHTGPVLAGVVGEKMPRYCLFGDTVNIA
SRMESHGVPSKIHLSASVHQCLKDKNFEMLERGEIDVKGKGKMYTYFLIRNITTTENEIM
GRPASQLDLSHDPAHLTQEGRPEAFQKSCSQDMPANSDEELLPAIAMKYADSSTEAYTNI
KGRNETRVKDLSGNPHDAEAYIILHGDQQPSKEPHPHHLQERSKPVAQDAPVRNVRSNFC
NLL
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atgtatggcttcataaatacatgcctgaagtctctagtggttgaaaaatatggtgaagaa
acatgggaaaaattgagagcccaaacgggagtacaggacaccttcctgacatttgaagtt
tatggagatgacatcacaatgcagctcattgacaaggcatgcaaaattttggatgttccc
cccgatatggtcctgaagcagtttggagagtatttcttcgaattttgtaagcggtcaggt
tatgaccacatgctgagaactctgggaggaaatctctatgaatttatagagaacttggat
gcattgcatagctacctgagtctatcttaccaggaaatgaatgctccttcgttcagggta
gaaaagaatgaagatgggtcaatgcatttacattattactcagacagacgaggcctgtgc
catattgttcctggaatcattggtgcagcagccttagattttttcaacattgaaacctcc
atggaaatagtcaatcaaacagaagaagaagaaagaactgggaaaaaggaacacattata
ttccttgtcacgcaaaaacctctatatccatgcaaaagaaaaaacaagttctcttcctcg
tcatcacacctttcaagttctggaatgcaggtggaaaagcagctgaaaaaagaggaaatc
gatagggccatgaataagatcagagataaagcaaatgtgctttcttcttgtcctgtgagg
aaaagccattgggaaacaatccgaggaattgtgaccataggaaaaggacgacttttaaga
gcatttaatcctgtctacccaaagaccctctggatagacccaaagacattctgcaatggg
cttcctttccatattgtttttgatgaagagctcaaagtaaagcaagctggtgtcagcatt
caaaagattgtgcctggccttcagactatgggcatccgactcaatcaatacttcagcatt
gtgcgcccagaagtgaaattcaccatctcaagtgttcagaaatttatcaatagccaattt
gttttccggaccaagagagagatgatgccagagtcctggcagcagcgcccgatgttagaa
ctaagagggcagatgatctggatggagtcggtccagtgtatgctctacctttgctctcct
ctcctgcgcacactgcacgagctggaggagaggcacatgcatattgccgacattgcaccc
catgatgtcacccgggatctgatccttctcaaccaacagcggctggctgaaatggagctc
tccaatcagcttgagaggaagaaagaggaattgcggatcctgtccaagcacttggaggaa
gagaagaagaaaacggaaacccttctttatgccatgctcccaaaacatgtggccaaccag
ctcaaagaagggaaacgagttgaggcaggagagtttaaagaatgcaccatattattcagt
gatgttgtgacttttaccaacatttgtgcccagtgtgaaccgattcagatagttctcttg
ttaaatgcgatgtacctgcgattcgacagactgaccacagtgcacgatgtctacaaggtg
gagaccataggggatgcctacatggtggttgggggtgttcctgtgcctgtatcaacacat
gctgaacgagttgccaactttgccctaggaatgataatagcagccaaagacatcaagaat
ccagtttctggcaatcctattcaaattagagttgggatccacacagggcctgtcctcgct
ggtgttgttggagaaaaaatgccgcgttattgcttgttcggagacactgtgaatattgcc
tcccggatggagagtcacggagtaccaagcaaaattcacctgagtgccagcgtgcatcaa
tgcttaaaggacaaaaattttgagatgctagaaagaggagagattgatgtgaagggaaaa
gggaaaatgtacacttattttctgatccgaaacataactacaactgagaatgaaataatg
ggacggccggctagtcaactggacctcagccatgatcctgcccacttaactcaagagggc
agacctgaagcattccagaagtcctgttcacaagatatgccagcaaattcagatgaggaa
ttgcttccagccatagcaatgaaatatgcagatagttccacagaagcctacaccaacatt
aaaggaagaaacgaaacaagagtgaaggatttatcaggcaacccacatgatgcagaagcc
tacataattctccatggtgaccagcagccaagcaaagaacctcaccctcatcacttacaa
gaaagaagtaagccagtggcacaggatgctcctgtcaggaatgtccgatctaatttctgc
aatctgctttaa

DBGET integrated database retrieval system