KEGG   Pogona vitticeps (central bearded dragon): 110072285Help
Entry
110072285         CDS       T05000                                 

Gene name
HTR4
Definition
(RefSeq) 5-hydroxytryptamine receptor 4
  KO
K04160  5-hydroxytryptamine receptor 4
Organism
pvt  Pogona vitticeps (central bearded dragon)
Pathway
pvt04020  Calcium signaling pathway
pvt04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    110072285 (HTR4)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110072285 (HTR4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pvt04030]
    110072285 (HTR4)
G protein-coupled receptors [BR:pvt04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    110072285 (HTR4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 110072285
NCBI-ProteinID: XP_020636137
Position
Unknown
AA seq 381 aa AA seqDB search
MDVSSIEEFGVAKIVLLSFISAVILMAILGNLLVMVAVCRDRQLRKIKTNYFIVSLAFAD
LLVSVLVMPFGAIELVQDNWIYGKMFCLIRTSLDVLLTTASILHLCCISLDRYYAICCQP
LVYRNKMTPLRIALMLGGCWVIPLFISFLPIMQGWNSIGIMDLIEKRQFNNVSNSTYCIF
MVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAREHAHQIQILQRAGAPTDGRPHHPDQH
STHRMKTETKAAKTLCIIMGCFCLCWAPFFITNVIDPFIDYAVPGEIWTAFLWLGYINSG
LNPFLYAFLNKSFRRAFLIILCCGDERYRRPSILGQTVPCSTTTINGSTHVLRYTVLHNG
HHLEHDKLPIHNDPESQESCF
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atggatgtgagctcaattgaggaatttggcgtggcaaagatagtgctgctcagcttcatc
tctgcagttattcttatggctatcctggggaatctactggtgatggtggctgtatgcagg
gacagacagctcaggaagataaagaccaattacttcatagtatctcttgcatttgctgac
ttgctagtatcagttttggtgatgccattcggagccattgaactagttcaagataactgg
atttatggaaagatgttctgtttgatccgcacatccctagatgtcctcctcaccacagca
tcaattcttcatctctgctgtatatctctagacaggtattatgctatctgctgccagccc
ctggtttatagaaataagatgactcccttgcgcattgcactaatgctgggaggctgctgg
gtaatcccgttgtttatttcttttctccctataatgcaaggctggaatagtattggcatc
atggacttgatagagaaaaggcagttcaacaatgtatccaactcaacctactgcattttt
atggtcaacaagccttatgccatcacttgctctgtggtggccttctacattccatttctg
ctaatggtgctggcctactaccggatatatgttacagccagggagcatgctcaccagata
caaattctacagcgtgcaggtgcaccaacagatgggaggccgcaccatcctgatcagcac
agcacacatcgtatgaagactgaaactaaggcagccaagactctctgtatcatcatgggg
tgtttctgtttatgctgggcacccttctttatcacaaatgtaatagatcctttcatagat
tatgcagttcctggggagatatggactgctttcttgtggctgggatacatcaattcagga
ttgaatcctttcctttatgcattcttgaacaagtctttcagacgtgccttcctcatcatc
ctgtgctgtggtgatgaacgatatagaaggccttccatcttgggacaaactgtcccttgt
tctaccactactataaatggatcaactcatgtgctaaggtatacagtgttacacaatggg
catcacctggaacatgacaagcttccaatccacaatgacccagaatcccaagagtcctgc
ttttga

DBGET integrated database retrieval system