KEGG   Pogona vitticeps (central bearded dragon): 110073029Help
Entry
110073029         CDS       T05000                                 

Definition
(RefSeq) uncharacterized protein LOC110073029
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
pvt  Pogona vitticeps (central bearded dragon)
Pathway
pvt00430  Taurine and hypotaurine metabolism
pvt00480  Glutathione metabolism
pvt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    110073029
   00480 Glutathione metabolism
    110073029
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pvt01002]
    110073029
Enzymes [BR:pvt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     110073029
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     110073029
Peptidases and inhibitors [BR:pvt01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   110073029
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G_glu_transpept DUF5106
Motif
Other DBs
NCBI-GeneID: 110073029
NCBI-ProteinID: XP_020637496
Position
Unknown
AA seq 558 aa AA seqDB search
MSELKFCSRRSPVICTNACVASSQPLATNIGLDILKNGGNAVDAAVAVAAALNVTEPCST
GIGGDCFCLYYDASTKQVHGLNGSGRSPQSLSIELLKEHGFSEANPPPALHAYNVTVPGA
AAGWCDAVALYGSQKLSMRDILQPAIELAENGFPVSEITSYQWKMNAYALQTPGNKHGKD
LLIEGQAPDHGQLFYNPFLANTFKELAKSGRQGFYEGRVAQAIVDVIQSNGGVMDLEDLK
SHGTTELKPIVTNYKGLKIWEIPPNGQGITVLLALNILENFNVKEMGHNTAEYLHLLTEV
LKISFADSFWFCADPEKIPVPTAKLLSKSYAKDRSKLIDLQRAATRYHHGNPSPLGNDTV
YFTVLDAQGNACSFINSNYMGFGTGLVPEGCGFTLHNRGANFSLKPDHPNCLAPRKRPYH
TIIPALATAADSGELLCSFGVMGGFMQPQGHIQVLLNMLEFGMNPQEALDAARFCVEYDK
KGHVWHVSLEDGIPQCITEELRARGHAVTAPVTGHSRSMFGRGQIIAKGDWWRRTQLSSK
NVIWAGSDPRADGCALGY
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgtcagagcttaagttctgttcccggagatctccagtgatttgcaccaatgcctgtgtt
gcatcaagccagcctcttgccacaaacattggccttgacattttaaagaatggcggcaat
gctgttgatgctgcagtggctgtagcagctgctttaaatgtcactgaaccatgcagtact
ggcataggtggagattgcttctgcctctactatgatgcaagcacaaagcaggtgcatggc
ctcaatggaagtggccggtctccgcagtccctatcaattgaactgctaaaagaacatggc
ttcagtgaagcaaatcctccacctgcattgcacgcatataacgtaacagtgccaggtgct
gcagctggctggtgtgatgctgttgcgctgtatggaagccaaaagctttccatgagagat
attctgcagccagcaatagaactggcagaaaatggtttccctgtgtcagaaattacttca
taccagtggaagatgaatgcttatgctcttcagacaccaggaaacaaacatgggaaggac
ctgctaattgagggccaagcacctgatcatggtcaactcttctacaatccatttttggca
aatacttttaaagaactggcaaaatctggcagacaagggttctatgaaggccgtgtagcc
caagctattgtggatgtcattcagagtaatggtggggtaatggatttggaagatctgaaa
agccatggcactacagaactcaaaccaattgtcacaaattataagggtctgaaaatctgg
gaaatccctccaaatgggcaaggaatcacagttctgttagccctgaatattttagaaaac
ttcaatgtgaaagaaatgggtcataatactgccgaatatttgcaccttctaactgaagtt
ctgaaaatcagctttgctgatagtttctggttctgtgcagatccagaaaaaattccagta
cctacagcaaaactcctttcaaaatcttatgccaaggaccgttcaaagctaattgattta
cagagagcggctaccagatatcatcatggaaatccttccccacttggaaatgacactgtt
tacttcacagtgttggatgctcaagggaatgcctgctctttcattaacagcaactatatg
ggatttggcacagggctggtgccagaaggctgtggatttacattacataacagaggagct
aatttttcactaaagcctgaccacccaaactgcctagcaccaaggaagcggccgtatcac
accattatacctgcactggccactgcggcagattcaggagagctcctgtgttcctttgga
gtaatgggtggattcatgcagccccaaggacacatacaggtcctattgaacatgttggaa
tttggaatgaatccacaagaggctttggatgctgctcgtttttgtgtggaatatgataaa
aaaggccatgtatggcacgtgtccctggaagatggtatccctcagtgcatcacagaagaa
ttgagagccaggggtcatgctgtcacagcacctgtaactgggcacagcaggagcatgttt
ggaagaggtcaaattatcgccaaaggagactggtggaggcggacacagctgtcttctaaa
aatgtaatctgggctggatctgaccctcgagctgatgggtgtgcattaggatactag

DBGET integrated database retrieval system