KEGG   Pogona vitticeps (central bearded dragon): 110073773
Entry
110073773         CDS       T05000                                 

Gene name
RDH5
Definition
(RefSeq) 11-cis retinol dehydrogenase
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
pvt  Pogona vitticeps (central bearded dragon)
Pathway
pvt00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    110073773 (RDH5)
Enzymes [BR:pvt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     110073773 (RDH5)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR DUF1776 NAD_binding_10
Other DBs
NCBI-GeneID: 110073773
NCBI-ProteinID: XP_020639010
UniProt: A0A6J0SZ53
Position
Unknown
AA seq 319 aa
MWCSVLLVSLLWIVIWFIRDRQTLSSFKDKYVFITGCDSGFGNLLAKRLDKKGFRVLAGC
LTQKGADNLQRASTPSLRTVLIDVTNSESIRKAVEWVKGEVGDKGLFGLVNNAGVANPIG
PTEWMNVDDYRKVMAVNTFGVIEVSLAFLPLLKRARGRVVNTSSVLGRLSANGGGYCISK
YTIEAFSDNLRRDLYHFGIKVSIVEPGFFKTAVTNLDSIEASLRQLWDRMDPEARQSYGE
DFFSNYLKVQKFIMNIICDPDLSKVTNCMEHALEAKHPRTRYSAGWDAKFVWLPASYLPA
FIVDIALAIILPKPAHRVR
NT seq 960 nt   +upstreamnt  +downstreamnt
atgtggtgctccgtgctgctcgtcagcctcctctggatcgtgatctggttcattcgtgac
cgtcagactttaagttccttcaaggataagtatgttttcatcacaggctgcgattcaggt
tttgggaacctgttagccaagcggctggacaagaagggcttccgggtgttagccggctgc
ctgactcagaaaggggccgacaacctccagcgggccagtacgcccagcctgcgcaccgtc
ctgatcgacgtcaccaattccgagagcatccgcaaagccgtggagtgggtgaagggcgaa
gtgggcgataaagggctttttggtctggtgaacaacgctggtgtggccaatccaattggc
ccaacagagtggatgaatgtggatgattaccgcaaggtcatggctgtcaacacttttggg
gtgattgaagtatctttggccttcctgcctctgctgaaacgagcacgtggccgtgtggtc
aacacctccagcgtcttgggtcgcctctcagccaatggtggtggctattgcatttccaaa
tacaccatcgaggccttctctgacaacctcaggagggacttgtaccattttggaatcaag
gtctccattgtggagccaggcttcttcaagacggccgtgaccaatcttgactccatagag
gcttccttgcggcagctctgggaccgcatggatccggaggcccgacagagctatggagaa
gacttcttttcaaactatctgaaagttcagaagttcataatgaatatcatctgtgatcca
gaccttagcaaagtgacgaactgtatggagcatgcgctggaggccaagcatcctcgcacc
cgttatagtgctggttgggatgccaagtttgtatggctgccagcctcttatctacctgcc
ttcatagtggacattgctctggctatcattctaccaaagccagcccatcgggtgcgctag

DBGET integrated database retrieval system