KEGG   Pogona vitticeps (central bearded dragon): 110078502Help
Entry
110078502         CDS       T05000                                 

Gene name
EIF3C
Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit C isoform X1
  KO
K03252  translation initiation factor 3 subunit C
Organism
pvt  Pogona vitticeps (central bearded dragon)
Pathway
pvt03013  RNA transport
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    110078502 (EIF3C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:pvt03012]
    110078502 (EIF3C)
Translation factors [BR:pvt03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    110078502 (EIF3C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF-3c_N PCI
Motif
Other DBs
NCBI-GeneID: 110078502
NCBI-ProteinID: XP_020648426
Position
Unknown
AA seq 913 aa AA seqDB search
MSRFFTTGSDSESESSLSGDELVAKPVGGNYGKQPLLLSEDEEDTKRVVRSAKDKRFEEL
TNLIKTIRNAMKIRDVTKCLEEFELLGKAYGKAKSIVDKEGVPRFYIRILADLEDYLNEL
WEDKEGKKKMNKNNAKALSTLRQKIRKYNRDYETQITGYRQNPEQSADEDEDKKSDDSEG
SSSSDDDDDEGMSAAAFLKKKEGAIEGRGKFLKKVEQDEDEEEEDSDDDEDWGSSGSESD
SESDEDEGKYTSLASKFLKKPGTEEEKRVMEKKREEKAKKKQDRKSKRYEDDEEDNEGGE
WEKVKGGVPLVKEKPKMFTKGTEINHAVVVKKLNEILQARGKKGTDRAAQIDLLQLLVGI
AAENNLGVAMDVKIKFNIVASLYDYNPNLATYMKPEMWQKCLECIDELLDILFAQPNIFI
GENIAEDSENLSNSEQPYRIRGCILTLVERMDEEFTKIMQNTDPHSQEYVDHLKDEGRVC
KIINRVQTYLQDKGTTEEICRIYLRCILHTYYKFDYKAHQRQQGPAGDSKSEQDQAENEA
EDSAVLMERLCKFIYARDRTDRIRTCAILCHIYHHALHDRWYQARDLMLMSHLQDNIQHA
DPPVQILYNRTMVQLGICAFRQGMIKDAHNALLDIQSSGRAKELLGQGLLMRSMQERNQE
QEKIEKRRQVPFHMHINLELLECVYLVSAMLLEIPYMAAHEFDARRRMISKQFHHQLRVG
ERQPLLGPPESMREHVVAASKAMKMGDWKTCHRFIVNEKMNGKVWDLFPEADKVRGMLVR
KIQEESLRTYLFTYSSVYDSISMEILSDMFELDLPTVHSIISKMIINEELMASLDQPTQT
VVMHRTEPTAQQNLALQLAEKLGSLVENNERVFDQKQGTYGGYFRDQKDGYRKNEGGYLR
RGGYRQQERQSNY
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcggttttttactactggctcagacagtgagtcagagtcatcactctctggagat
gagttggtggccaaacctgttggaggcaactatgggaaacagcctctattgctgagtgaa
gatgaggaagatacaaagagagttgtacgcagtgcaaaggacaaaaggtttgaagaactt
accaacttaatcaaaacaatccggaatgccatgaagatccgggatgtcaccaaatgcctg
gaggaatttgaattgctgggcaaggcttatgggaaagccaaaagcattgtcgacaaggaa
ggggtgccccgcttctacatccgtatcctagcagatcttgaggattatctcaatgagctg
tgggaggacaaagaaggcaaaaagaagatgaacaagaacaatgccaaagccctgagcacc
ctccgtcagaagatccgaaagtacaaccgggattatgagacccagatcacaggctatcgc
cagaaccctgagcagtcagctgatgaagatgaggacaagaaaagtgatgattcagaggga
tcctcctcttcagatgatgatgatgatgaaggaatgagtgctgccgctttcctgaagaaa
aaggaaggggcaattgagggacgtggcaagttcctcaaaaaggtggagcaggatgaagat
gaggaagaggaggactctgatgatgacgaagactggggctcatcaggttcagaatcagat
tcggagtcagatgaagatgagggcaaatacacgtccttggcctcgaaatttcttaagaaa
cctggcactgaagaagaaaaaagggtcatggagaagaaacgagaagagaaggcaaagaag
aagcaggaccgcaagtccaagagatacgaagatgatgaagaagacaacgagggcggcgag
tgggagaaggtcaagggtggtgtcccgctggtcaaggaaaaacccaagatgttcactaaa
ggcacagagatcaaccacgctgtggtcgtgaagaagctgaatgagatcttgcaggcccgt
ggaaagaagggcacggatcgggcagcacagattgatcttctgcagcttctggttggaatt
gcggcagagaacaatttgggtgttgccatggatgtcaaaatcaagttcaacattgttgct
tcgttgtatgattataaccccaatctggctacatacatgaagccagagatgtggcagaaa
tgcctggaatgcattgatgagcttctggacatcctctttgctcagcccaacattttcatt
ggtgagaacattgcggaggactctgagaacctgtccaacagcgaacagccctaccgcata
cgtggttgcatcctgaccctcgtggaacggatggatgaggagttcaccaagatcatgcag
aacacagatccccattcccaagagtatgtggaccacttgaaggatgagggccgagtatgc
aaaatcatcaaccgagtacagacctacctgcaggacaaggggaccacagaggagatctgc
cgtatctacttgcgctgcatcctccacacctactataagtttgactacaaggctcaccag
cgccagcaggggccagcaggagacagcaagtctgagcaagaccaagcagagaatgaagct
gaggactcagcggtgctgatggagcgtctctgcaagttcatctatgccagggaccggaca
gacagaatccgaacctgcgccatcctctgccacatctaccaccatgccttgcatgaccgc
tggtaccaggctcgagatctgatgctgatgagtcacctgcaggacaacatccagcacgca
gatcctccagtgcagattctatataaccggacgatggtgcagctaggaatctgtgctttc
cgccagggcatgattaaggacgcccacaatgccctcctggacatccagtcaagtgggcga
gccaaggagctgctagggcagggcctgctcatgcgcagcatgcaggagcgcaaccaggag
caggaaaagatcgagaagcgccgccaggtccccttccacatgcacatcaacctggagctt
ctggagtgtgtctacctggtgtccgccatgttgttggaaatcccctacatggctgcccat
gaatttgatgcccgtcggcgcatgatcagcaagcagttccaccatcagcttcgtgtaggc
gagcgccagccactacttggccctccggaatcaatgagggagcacgtggtagcagcatcc
aaagctatgaagatgggtgactggaaaacctgtcaccgtttcattgtcaatgaaaaaatg
aacgggaaagtctgggatctgttcccggaggctgacaaagtccgcggcatgcttgtccgg
aagatccaggaggagtctctccggacctatcttttcacttacagcagtgtctatgactcc
atcagcatggagatattgtctgatatgtttgagctggacctgcccacagtgcacagtatc
attagcaagatgatcatcaatgaagaactcatggcctccttagaccagccaacccagacg
gtcgtgatgcatcggacggagcccacagcccagcagaacctggcgcttcagctggccgag
aagctgggcagcctggtggaaaacaacgagagggtctttgaccagaaacaaggcacctac
gggggttacttccgggaccagaaggatggctatcgtaagaacgaaggaggctacttgcgg
cgtggagggtatcgacagcaagagcgacagagtaactattga

DBGET integrated database retrieval system