KEGG   Pogona vitticeps (central bearded dragon): 110078753Help
Entry
110078753         CDS       T05000                                 

Definition
(RefSeq) carnitine O-palmitoyltransferase 2, mitochondrial-like
  KO
K08766  carnitine O-palmitoyltransferase 2 [EC:2.3.1.21]
Organism
pvt  Pogona vitticeps (central bearded dragon)
Pathway
pvt00071  Fatty acid degradation
pvt01212  Fatty acid metabolism
pvt03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    110078753
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    110078753
Enzymes [BR:pvt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     110078753
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf
Motif
Other DBs
NCBI-GeneID: 110078753
NCBI-ProteinID: XP_020648863
Position
Unknown
AA seq 661 aa AA seqDB search
MHRARPHWGAATLRSRGYWRTVGQPEGIVSEQDTDHHFVHRSTIPTMHFQPSLPRLPIPK
LEDTIKRYLAAQKPLLNYEQYRYTKKIAREFEAGEGKLIHRDLLEHDKINKHTSYISAPW
SDMYLSAREPIVFNYNPFITLNPDPNPRYSNQIVRATNLVVSSLKFLNSLKNDYLRPDIY
YVNRRWGQSKVFKHFIRMLPPTLSWYGAYLVNAYPLDMSQYKSLFNSTRIPNLSKDSLFT
DEFARHLLVMRNGHFYVFEVLDPFGNILHPSEIQAHLTQIIHDADRLPGFELSLLTTEER
NTWATLRQELVLKGNEENLKKIDSAVFCLCLDNTSPKNETELAHCFLHGYGFNRWFDKSF
SLIVTSDGTAGINFEHSWGDGVAILRFINEVYRDSTEHPALVPEASPAFFVTSCDKLEFN
LGCTITSAINAARIKFNEKRERLCVRSFRYEQFGKQFAMNQNLSPDAVFQLACQMAIYRQ
YRKLVPSYEACSTAAFKHGRTETIRPTSVYTKKCATAFFDERGKYSIEDMRNMIDECSRY
HKRLQLEATLGQGFDRHLFALKYLVQRRGGRIPDIYNDPAYKNINHIIVSTSTLGSPAVH
YGGFGPVVPDGFGVGYNVFDTWIGCIITNYSEEDLEELLKNLEYTLNDIFDILEGRKLQQ
C
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgcaccgagctagaccccactggggcgccgcaaccctgcggagccgtgggtactggagg
accgtggggcagccggagggcatcgtctcggaacaggacaccgaccaccacttcgtgcac
cggagcaccattcctaccatgcacttccagcccagcttacccagattgcctattccaaaa
ctggaagatactatcaagagatacctagctgcccaaaaaccactactgaattatgaacaa
tacagatatactaaaaaaattgccagagagtttgaagccggagagggcaagttaatacat
cgtgatctacttgaacatgataaaattaataagcatacaagttatatatcagcaccttgg
tctgacatgtatctttcagcaagagaacctattgtttttaactacaacccttttattact
ttaaatcctgatccaaacccaagatacagcaatcaaatagtgagagcaacaaatctggtt
gtatcatcattaaagtttcttaactctctgaagaatgactatttgcgaccagatatatat
tacgtaaaccgcagatggggtcagagtaaagttttcaaacactttatacgtatgctacca
cctactttatcttggtatggagcttatttggtgaatgcttatcctttagatatgtcacag
tataagtcacttttcaacagtaccaggattcctaatttaagcaaagattcattgttcaca
gatgaatttgcaagacatttgttggtgatgagaaatggtcatttttatgtttttgaagta
ttggatccttttggtaacattctacacccatctgaaattcaggctcatttaacacaaata
atacatgatgctgatcggttgcctgggtttgaactctccctcctgactactgaagaaaga
aatacctgggcaacattaaggcaagaacttgtcctgaaaggtaatgaagaaaacctaaag
aaaattgacagtgcagttttttgtctttgtttagataacacttcccccaaaaatgaaact
gagcttgcacattgttttcttcatggatatggctttaatcgctggtttgacaaatccttt
agtctgattgtcacaagtgatggtactgcaggaataaattttgaacactcttggggtgat
ggagttgcaattctacgatttataaatgaagtatatagagacagtacagagcatccagct
cttgtaccagaagccagtccagctttttttgttacgtcatgtgacaaactggaatttaat
ttgggatgcaccataacatctgccataaatgctgcacgtataaaattcaatgaaaaaagg
gaaaggctttgtgttagatcatttaggtatgaacaatttggaaaacagtttgcaatgaat
caaaacttgagccctgatgctgtgtttcagcttgcatgccaaatggccatctatcgccag
tacagaaaattagtgccttcttatgaagcttgcagtactgcagcttttaagcatggtcgc
acagagacaattcgcccaacatctgtatatacaaaaaaatgtgccactgcattctttgat
gagcgaggaaagtatagcattgaagacatgagaaatatgattgatgaatgttcaaggtac
cataaacgcttacaactggaagctacattaggccaaggatttgatcgccatttatttgcc
ttgaagtaccttgtccagcgcagaggtggacgtattcctgatatttataatgaccctgct
tataaaaatataaaccatattattgtttcaactagtacattaggcagtccagcagttcat
tatggtgggtttggaccagtggtgccagatggttttggtgtgggttataatgtgtttgat
acttggataggatgcattataactaactattcagaggaagacttagaagaacttctgaaa
aaccttgaatatactttgaatgatatatttgatattttagaaggaagaaaacttcagcag
tgttaa

DBGET integrated database retrieval system