KEGG   Pogona vitticeps (central bearded dragon): 110078766
Entry
110078766         CDS       T05000                                 

Gene name
ERAP1
Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
pvt  Pogona vitticeps (central bearded dragon)
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pvt01002]
    110078766 (ERAP1)
Enzymes [BR:pvt01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     110078766 (ERAP1)
Peptidases and inhibitors [BR:pvt01002]
 Metallo peptidases
  Family M1
   110078766 (ERAP1)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N DASH_Duo1 FlaC_arch
Other DBs
NCBI-GeneID: 110078766
NCBI-ProteinID: XP_020648885
Position
Unknown
AA seq 926 aa
MFMLCIAIGLFYSHHVGTAYSLSDNGGNPFPWNKMRLPRHVFPIHYDLLIHPNLTTLTFT
GLTKIEITVTQETNSIILHSKYLQITKATIQKAMESTGIDDKVVVLEYPPFEQIALLAAE
PLQVGSYVVRIEYAANLSESYHGFYKSTYRTPEGEVRVLASTQFEPTTARMAFPCFDEPA
FKAIFSVKLRREPKHLALSNMPLVKSIILKEWLIEDHFEISVKMSTYLVAFIVSDFKSVS
KMTSRGIKVSVYTVPHKINQADYALDAAVKLLDFYEEYFSIPYPLPKQDLAAIPDFQSGA
MENWGLTTYRESALLYDPEKSSASSRLGITLVVAHELAHQWFGNLVTMEWWNDLWLNEGF
AKFMEFISTSVTHPELKVEDYFLNKYFQAMEVDALNSSHPISTPVEDPSQILEMFDDVSY
DKGACILNMLQDYLTPEVFKAGLVKYLVRFSYQNTRNEDLWNSLSDVCPVDDSEESRVQN
TGFCARNKETISNDHWKKSDFHDVKTMMNTWTLQKGYPLVTVTMKGRNIHLQQEHYMKSS
SFSSRTGNLWHVPLTYITSKSAIVQRFLLTTKTDDIVLPEEVEWIKFNVGMNGYYIVDYG
DDGWDALVRLLKENHKVISSNDRASLINNAFQLVSVGKLSITKALDLTLYLKHESENTPV
LQGLDELIPLYKLLEKRDMNETEHQLKGYIANLFKTIIDAQSWDDEGTMSERVLRSSLLV
FACVRKYQPCVDKAKEYFMKWKNSNGTLKLPNDVKFAVYAVGAQTDEGWDFLFNKYQLPE
FSTEKNVIEAVLSLSQNVEKLQWLMDQGLQGDIIKTQNLPYIVTSVGRNPVGYKLAWKFL
KENWEKLVKKFELGSHSIAHMVAGVTNKYSTKAQLAEVKDYFNSLDKKSSELRAVQQAIE
TIKDNIRWMDENLEKIKKWLQANSKV
NT seq 2781 nt   +upstreamnt  +downstreamnt
atgttcatgctatgcattgctattgggttgttctatagtcaccatgttggaacagcatat
tcactcagtgacaatggtggtaatccatttccatggaataaaatgaggctccccaggcat
gtctttccaattcattatgaccttctgatccatccaaatcttaccactctgacctttacg
ggattgacgaaaattgagattacagtaacccaagaaactaattcaatcatcctgcacagc
aagtatctccagattaccaaagctacgatccaaaaagcaatggaaagcaccgggattgat
gacaaagtggtggttttagagtatccaccgtttgaacaaattgcacttcttgcagctgaa
cctctgcaagttggtagctacgtggttagaattgagtacgctgccaatttatctgagagt
tatcatggtttctataaaagcacatacagaactccagaaggagaagtaagggtgcttgca
tcaacacagtttgaaccaacgactgcacgaatggccttcccttgctttgatgaacctgca
ttcaaagctatattttctgttaagctcagaagagaacccaaacaccttgcactatctaac
atgcctctggtgaaatctattattcttaaggaatggctcattgaagatcacttcgagatc
agtgtaaagatgagcacttatctagtagccttcattgtttccgatttcaaatcagtttcc
aagatgaccagccgtggaattaaggtttcagtgtacactgttccacataagatcaaccaa
gctgattatgctttggatgcagcagtgaagctcctagatttctatgaagaatattttagc
attccatatcctttgcccaaacaagacttggcagctattcctgattttcagtctggtgca
atggagaactggggattgactacatacagggaatctgctttgttatatgacccagagaag
tcctctgcatcaagtagacttggaattaccttagttgtagcccatgaacttgctcaccag
tggtttggaaacctggtgaccatggagtggtggaatgatctttggctcaatgaaggattt
gcaaaatttatggaatttatctcaacaagtgttacccacccagaactgaaagttgaagat
tattttttgaacaaatattttcaagccatggaagtagatgctttaaattcttcacatcct
atatctactcctgttgaagatccatctcagatcctagaaatgtttgatgatgtttcctat
gacaagggagcatgtattttaaatatgttacaggattatctcactccagaagtctttaaa
gctggacttgttaaatatttggttcgattcagttatcagaatacacgaaatgaagatctg
tggaacagtttgtcagatgtttgtcctgtggatgattctgaggaaagtcgtgttcaaaat
actgggttttgtgcaagaaacaaggagacaatctcaaatgatcactggaagaaaagcgac
ttccatgatgtgaagacaatgatgaatacttggacactgcagaaaggatacccactagtg
actgttacaatgaaagggaggaacattcatttgcaacaagagcactatatgaagagctct
agtttttcttcgcgaacagggaatctgtggcatgttccattaacatatattactagtaaa
tctgccattgttcagagatttttgctgacaacaaagacagacgatatcgttctcccagaa
gaagtggaatggataaaatttaatgtaggcatgaatggttattatattgtcgactatgga
gatgatggatgggatgctttggttcgccttttaaaagaaaatcataaagtgattagcagc
aatgatagagccagcctcatcaacaatgcatttcagctggtgagtgttggaaagctgtca
attaccaaagctcttgatttaacattatacctaaaacatgaatctgaaaatactcctgtg
cttcaaggactggatgaactaattcctttgtacaaactgctggagaagagggacatgaat
gagactgaacatcagttaaagggatacattgctaatctgttcaaaaccataattgatgca
cagtcttgggatgatgaaggcacaatgtctgagcgagttcttcggagctccctgcttgta
tttgcctgtgtacgcaagtaccaaccatgtgtggacaaagcaaaagaatatttcatgaaa
tggaaaaactccaatgggactctaaaattgccaaatgatgttaaatttgcagtatatgct
gttggagcacaaacagatgaaggctgggacttcctttttaacaaatatcagctacctgag
ttcagtactgaaaaaaatgtaattgaagctgttctcagcctgagccaaaatgtggaaaag
cttcagtggttaatggatcagggcttgcagggtgacataataaaaactcagaatcttccg
tatattgtcacgagcgttggaaggaatcctgttggttacaagttagcatggaaatttttg
aaggagaactgggagaaacttgtaaaaaagtttgaacttggttcacattccattgcacac
atggttgctggtgtaacaaataagtattctacaaaggcacagcttgcggaggtaaaagac
tatttcaactctcttgacaaaaaaagttcagagctccgtgctgtccaacaagccatagaa
accattaaagataatatccggtggatggatgagaatcttgaaaaaatcaaaaagtggtta
caggccaatagcaaagtatga

DBGET integrated database retrieval system