KEGG   Pogona vitticeps (central bearded dragon): 110079007Help
Entry
110079007         CDS       T05000                                 

Definition
(RefSeq) cytosolic phospholipase A2 epsilon-like
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
pvt  Pogona vitticeps (central bearded dragon)
Pathway
pvt00564  Glycerophospholipid metabolism
pvt00565  Ether lipid metabolism
pvt00590  Arachidonic acid metabolism
pvt00591  Linoleic acid metabolism
pvt00592  alpha-Linolenic acid metabolism
pvt01100  Metabolic pathways
pvt04010  MAPK signaling pathway
pvt04217  Necroptosis
pvt04270  Vascular smooth muscle contraction
pvt04370  VEGF signaling pathway
pvt04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    110079007
   00565 Ether lipid metabolism
    110079007
   00590 Arachidonic acid metabolism
    110079007
   00591 Linoleic acid metabolism
    110079007
   00592 alpha-Linolenic acid metabolism
    110079007
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110079007
   04370 VEGF signaling pathway
    110079007
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110079007
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    110079007
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    110079007
Enzymes [BR:pvt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     110079007
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B cPLA2_C2 C2
Motif
Other DBs
NCBI-GeneID: 110079007
NCBI-ProteinID: XP_020649391
Position
Unknown
AA seq 810 aa AA seqDB search
MGVYGSKQKVESAPCSILTVKIIKIKNLRKADLFTQSDCYVTLWLPTASMKRTKTQTVND
TKDPVWNESFHFRIQNQVKNILELKVCDEDKQTADDHLLTVFFDVSKIQLGETVCLSFQL
NPKGKEELEVEFTLESSPDVPEKIFTNGVLVSREVACMEVQVDGGRIKTERKFTLSLDGS
YEEAQNLTLRTWLCRASPAKFHYIKYNQSELGIELPRRQLCVASQERNESTIVPLNSLPL
QENVTIPPNKTFDLSVKTKDWTQGLLFKRPKDLDVRLSYDLCLDEQNFLTKRKKVVAATL
KNLLHLGEGLKDQEVPVVAVTTTGGGMRALAAMYGTLWGLQRMKLLDCVSYITGSSGTTW
TMTDLYEDADWSYKDLGEIIKKARKQAAKSKINAFSLESLKAYHKELCLRTIAGYKTSFI
DLWGLMIEAMLNDGSNNHKLSDQRRAVSRGQNPLPIYLALNVKDKITTRNFREWVEFTPY
EVGFLKYGAFVQAEDFGSEFFMGHLMKKLPESRICFMQGMWSSVFSKNLLDAWHAADNSE
DFWNRWTQDTITEIEEIPDLPEKPHEMPTRMFTPAGSLSSSLRDIVTDRPSVSKYHNCLR
GLQMHNEYTQNPQFCKWKDTTLDDSPNQLRDPEDNLELVDTAFFFDTSCPPLLRPERKVD
IILHFNYTGGSQTKPLERASTYFTEQGIPFPKVELSDDEKKNLKECYVFEDTDNPEAPTV
IYFPLINDTFQRYLAPGVERSAGEMSLGHVDVSSAFSPYSTRQVSLQEEDFNKLLNLTNY
NVQNNASTIMQVLHNTVEKKKQAQTSQISS
NT seq 2433 nt NT seq  +upstreamnt  +downstreamnt
atgggggtgtatggaagtaaacaaaaggtagagtctgctccttgcagcatcctcactgtc
aagataataaaaatcaagaatctccggaaggcagacctttttacccagtctgattgctat
gtgactttatggctgccaactgcttcaatgaaaagaaccaagactcagactgtgaatgac
accaaagatccagtgtggaatgaaagttttcacttccggattcaaaaccaagtaaagaac
attttggaacttaaagtctgtgacgaagacaaacagactgcagatgatcatcttctcact
gttttctttgacgtatctaaaatccaacttggagaaacagtttgcctcagctttcagctg
aatccaaagggtaaagaggaactagaagttgagttcacactggagagcagcccggatgtt
ccagaaaagatttttactaatggcgtcttggtgtctcgtgaagttgcctgtatggaagtt
caagtggatggaggaagaattaaaacagaaagaaaattcaccctatctttggatggatcc
tatgaagaagctcagaacctcacactacgtacctggctttgccgtgcgtctccagctaaa
ttccactatatcaaatataaccaatcagaacttggcattgaactgcccagaagacagcta
tgcgtggcttcccaagaaagaaatgagtcaacaattgttcccttgaactcacttccttta
caagagaatgtgactataccaccgaacaaaacatttgatttgagtgtgaagacaaaagat
tggacccagggcctgctgtttaaaaggccgaaagatctggatgtacgtctgagttatgac
ctgtgcttggatgaacagaatttcctgacaaaaaggaagaaagtggtggctgctacattg
aaaaatcttcttcatttaggggaaggcctgaaagaccaggaagtgcctgtcgttgctgtg
acaaccacagggggtgggatgagagcattagcagctatgtacggcactctttggggcctc
cagagaatgaagcttctagactgtgtttcatatatcactggttcatcaggtacaacatgg
accatgacagatttgtacgaagatgctgattggtcatataaagatcttggggagataatc
aagaaagctcggaagcaagccgccaaatctaaaataaatgccttttccttggaaagtctc
aaggcataccataaagagctgtgtctgaggaccattgcaggatacaagacatcatttata
gatctttggggactcatgattgaagccatgctgaatgatgggagcaacaaccataaactc
tcagatcagcgacgggcagtgagcagaggtcagaaccctcttcctatctatctggctctt
aatgttaaggacaagatcaccacaagaaatttcagagagtgggtggagttcacgccgtac
gaggtgggattcctgaaatatggagcctttgttcaagctgaagattttggaagtgaattt
tttatgggtcacctgatgaaaaagctcccagaatcaaggatctgctttatgcaagggatg
tggagtagtgtgttttccaagaatttgttggatgcttggcatgcagcagacaattcagag
gatttttggaacaggtggacccaagacactatcacagaaattgaggaaatacctgatttg
ccagagaaaccccatgagatgccaactcggatgtttaccccagcaggaagcctttctagt
tctctacgtgatattgtaacagatcgcccatcagtgtccaagtatcacaattgtttacga
gggttacaaatgcataatgaatatacccagaatccacagttttgtaaatggaaagacaca
actctcgatgactcccctaatcagttgcgagatcctgaagacaatctggaactggtagac
acagcatttttctttgataccagttgtcctccacttctgagaccagaaaggaaagttgat
atcatcctgcacttcaactatactggaggatcacaaaccaagcctctggagagggcctcc
acatatttcacagaacagggaatcccatttcccaaggtggagctaagtgatgatgaaaag
aagaacttaaaggagtgctatgtgtttgaagacacagacaacccagaagctcccaccgtg
atctatttcccacttataaatgataccttccaaagataccttgcacctggtgtggaacgc
agtgccggtgagatgtctctgggccacgttgatgtttctagtgccttttctccctattcc
acaagacaggtctcactgcaagaggaagatttcaacaagctgctgaatctaactaattac
aatgtccagaataatgcaagcacaatcatgcaggttttgcacaacaccgtagaaaagaaa
aaacaagctcagacatctcagatatcttcataa

DBGET integrated database retrieval system