KEGG   Pogona vitticeps (central bearded dragon): 110079591
Entry
110079591         CDS       T05000                                 

Gene name
ADAMTS13
Definition
(RefSeq) LOW QUALITY PROTEIN: A disintegrin and metalloproteinase with thrombospondin motifs 13
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
pvt  Pogona vitticeps (central bearded dragon)
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pvt01002]
    110079591 (ADAMTS13)
Enzymes [BR:pvt01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     110079591 (ADAMTS13)
Peptidases and inhibitors [BR:pvt01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   110079591 (ADAMTS13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 Reprolysin ADAM_CR_2 Reprolysin_4 Reprolysin_5 Reprolysin_3 TSP1_spondin Reprolysin_2 ADAM_spacer1 TSP1_CCN
Other DBs
NCBI-GeneID: 110079591
NCBI-ProteinID: XP_020650462
UniProt: A0A6J0TQA1
Position
Unknown
AA seq 1369 aa
MPVEQKPIRRRSPSRVRRKSERNVKHLELLVVVGPDVYQFHQEDTERYILTILNIAAELL
RDASLGIQFRVHLIGMIVLTEPESSIRLSSNITDSVISVCEWSRSVHPENDSDPRHADLV
LYVTRFDLELRDGNKQVHGVTQLGGACSTFWSCIITEDTGFGLGVTIAHEIGHSFGIQHD
GEGNPCPSSGHIMGSAGGHNSVDVTWSSCSREQLLAFISTGQASCVDDLPDFTETIPGRK
PGLYYGLDEQCKIAFGEAAIACTFTRHDLDMCKALSCHTNPADQSSCTRRFYPLLDGTEC
GLNKWCSKGRCSSSEDLDPIHGQWSSWTALTSCSRSCGGGVTARRRQCNNPRPAFGGHPC
EGKDVEAELCNVQYFSLGDGSICIVSFCPYPEFTTGVALPLPGDLMCKHMCQASGKNFMV
RRGDRFIDGTKCEPDSPEDGGKPGWCLTGRCKMFGCDGRMDSGKSADACQVCGGDNTTCS
HVNGSYTEGKAREYVTFLVLPPNTTTVRVVNRKPLFTHLAVKVGGQYVVAGKGAGKGSIS
YNTTFPSVLEDNRIEYKVFLTEDRLPRWEHVHMTGPLQEAAEIQVYRKYGKEYGAITNPD
ITFSYFRPNEKQAYGWAPQLGPCSVSCGEGKGRSALDPAVSPCWLADDFGPCSATCGGGT
RQRLVHCAKEDGGRILTLPDSECTEAARPSSIESCSSELCPPRWKESEPGPCSAVCGVGV
ASLNVTCVQVRDGLETIVEESFCSADEKPLDVAPCVVNVCPLGWDTKEVPDSASSDPFWP
PRIENRPVYIWSPVAGDCTVTCGGGLMLVSYVCLVFDTREEAKAERCNQTRKPSSQLEVC
NPMLCPPSWEVKELAPCPVTCGGGRIPLLVRCIRQHGNATKTLPHSKCGRTRRPASSKEC
ATEPCPARWFSKKGACSASCGGGVLHKVRYCARETGEKKEEEILPDAHCENLPHPEEQEA
CNPEPCPPRWKVTRTGPCSSSCGLGVATQTIACVQSSGSQEVELADDSCPEAEKPLASLP
CVVRECSYEWGFTQWTECSVSCGTGVQTRKDFCLNSQTRARVNPAWCMRTPKPLRVRTCS
VAPCFAPASADTTLAGLQRQPTAPGWRTTPSTTTSPARSRSRALGFPQLAVSPKHLKETD
WEDPSEEHGVCGRLFLGATGLINMTGLRVRDCAVAIGRPLQEIITLRVLESTLNCTAGEM
LLFSTRTMWRTGCKKLGLLVINNTKANTLMVRQRLLVPGNGVVLQYSSQAAPKRYHQDCD
VQLFGPRGEIVNPGPPADGESPASCRTFIDVAPRLRIAIRAVNVDLGTDAGQRPSGYILI
RDVSTMKTTVFRGNQLFYWESTGSRAEIEFSAELAHVPFRAEYWVTKPK
NT seq 4110 nt   +upstreamnt  +downstreamnt
atgccggtggagcagaagcccatccgacgaaggtctccgtcccgagttcgcagaaagtct
gagaggaatgtgaaacacttggagcttctggtggtggtcggtccggatgtctaccagttc
caccaggaagacacggagcggtacatcctcaccatcctaaacattgcagccgagctgctt
cgagacgcctcgctgggaatccagttccgcgttcatctcatcggaatgattgtcctcacg
gagcccgagagcagcatccgtctgtcctccaacatcaccgattcggtcataagtgtttgt
gagtggagcaggagcgtccacccggagaacgactccgatcctcgccatgcggatcttgtc
ctctacgtgaccaggttcgacctggagcttcgcgatgggaacaagcaggtgcacggtgtc
acccagctgggtggagcctgttccaccttttggagctgcatcatcacggaagacacaggg
tttggcctgggggtcaccatcgcccacgagatcgggcacagctttggcatccagcatgat
ggggaagggaacccttgccccagcagcggacacattatgggttctgcgggcggtcataac
agcgtcgatgtgacttggtcttcctgtagccgggagcagctcttagccttcatcagtaca
ggccaagccagctgtgtggatgacctgccagacttcacggagaccatccctggaaggaag
ccaggcctgtattatgggctagatgagcagtgtaaaatagctttcggggaagccgccatc
gcctgcaccttcacccggcacgaccttgacatgtgcaaagctctgtcttgccacaccaat
ccagccgaccagtccagctgtacccggcgtttctatcccctcctggatggcaccgaatgt
gggctcaacaagtggtgttccaagggtcgctgtagctcgtcggaagatctggatcccata
catgggcagtggagcagctggacggcgcttacctcctgctccagaagctgcggagggggc
gtcacagcaagacggagacagtgcaacaacccaaggcctgctttcgggggccacccgtgt
gaaggcaaggacgtggaagctgaactgtgtaacgtgcagtattttagcttgggtgatggg
tccatctgtattgtatcgttctgcccatacccggagttcaccaccggcgtcgccctccca
cttccaggagatctgatgtgcaaacacatgtgtcaagcgtccgggaagaacttcatggtg
agacgcggggaccgattcatcgatgggacgaagtgcgaacccgacagcccggaggacgga
ggaaaaccgggatggtgtttgacaggccgctgcaagatgtttgggtgtgatggcagaatg
gactctgggaagagtgcggacgcatgccaggtgtgtggcggagacaacacgacctgttcc
cacgtcaacggttcttacacagaaggaaaagccagagagtacgttaccttcctggtgctg
cctccgaacaccaccacggtgcgggtggtcaaccggaagcctctctttacgcatttggcg
gtgaaggtcggagggcagtacgtggtggcgggaaagggcgccggaaagggcagcatctct
tacaacaccaccttcccttccgtcctggaagacaaccggatcgaatacaaggtcttcctc
accgaggatcgcctgcctcgctgggagcacgttcacatgacgggacccctgcaagaggcc
gcagagatccaggtttataggaaatacgggaaggaatatggggccatcaccaacccagac
atcaccttcagctacttccgaccaaacgagaagcaggcatacgggtgggctccccagctt
ggtccctgctcagtgagttgtggggaaggtaaggggcgttcagccctcgatcctgccgtc
tctccttgctggttggccgacgactttgggccctgtagtgccacctgtggcggtggcacg
aggcagcgtctggttcactgcgcaaaggaagatggaggacggatcctgactctgccagat
tcagaatgcacggaggctgctcggccttcttccattgagtcctgcagctccgaattgtgc
cctcccaggtggaaagaatcggagccgggcccatgctctgccgtttgcggggtgggagtc
gcctcgttgaacgtgacctgcgttcaagtccgtgacggcttggaaaccatcgtggaggaa
agcttctgctcggcagatgagaaacccctcgacgtggcgccttgcgtggtgaacgtttgc
ccactagggtgggacacgaaagaggtgcctgattcagcatcttctgacccgttttggcct
cctcgtattgaaaaccggccagtgtacatctggagcccagtggctggagactgcaccgtc
acttgcggaggagggttgatgctggtgagttacgtctgtctggtttttgacactcgagaa
gaagctaaggcggagcgttgtaaccagacgcggaaaccgtcaagccagctggaagtgtgt
aaccccatgctatgtcccccaagctgggaggtaaaggaacttgctccgtgtcccgtcaca
tgcggtggaggaaggatccctctcctggtacggtgcatccggcagcatggaaacgccacc
aagacgctcccgcactcgaaatgtggcaggacgcgccggccggccagcagcaaggaatgc
gctactgaaccttgcccggcgaggtggttctccaagaagggtgcctgcagcgccagctgt
ggcgggggcgtcttgcacaaggtgcggtactgtgcgcgggagacgggagagaagaaggag
gaagagattctgccagacgcccactgtgagaatttgcctcatcccgaagaacaggaagcg
tgcaatccggaaccctgtcctccaaggtggaaagtcacaaggaccggtccgtgttcctct
tcctgcgggcttggggtggccacccaaaccatcgcttgcgtgcagtcttctggaagccaa
gaggtagagctggccgacgactcgtgcccggaagcagagaagcctctcgctagcctgccc
tgcgtcgtccgggagtgctcttacgaatggggattcacccagtggacggagtgttctgtt
tcctgtggaaccggggtccagacgcggaaggatttctgccttaattcccagaccagggca
cgggtgaaccccgcctggtgcatgcgcacccccaagcccttgagggtgaggacatgctcc
gttgccccgtgcttcgcaccggcctcagcagacacgactcttgcgggtctccaaaggcag
ccgaccgctccgggttggcgcacgacaccttccacgaccaccagccccgccagatcacga
tccagggctttaggttttccacaacttgctgtgtctcccaagcacttgaaagagacagac
tgggaagatccttcggaggagcacggtgtgtgtgggagactcttccttggtgccacgggg
ctgatcaatatgaccgggctacgagtgagggactgcgccgtggccatcggccgccccctg
caagagatcatcaccctccgggtgcttgagagtaccctgaactgtactgcaggcgagatg
ctgctgttttctacacggacgatgtggcggacaggatgtaagaaactggggctcttggtg
atcaacaacaccaaggccaacacgctgatggtgcgacagcggctcctggtgccgggaaac
ggagtcgtgctccagtacagcagccaggctgccccaaagagataccaccaagactgcgat
gtgcaattgtttggccctcgtggagaaatagtaaaccccgggccgcccgcagacggcgaa
tcgccagcgtcttgcaggacctttatcgatgtggctccacggcttcgtatcgccattcgt
gctgtgaacgtggacctgggaaccgacgccggccaaagaccttctggttatatcttgatt
cgagatgtcagcaccatgaaaaccaccgtcttccgcggaaatcagctgttctactgggaa
tccacggggagccgggctgaaatcgaattcagtgcagaattggcccacgtccctttccga
gcggagtactgggtgaccaagcccaaataa

DBGET integrated database retrieval system