KEGG   Pogona vitticeps (central bearded dragon): 110079850
Entry
110079850         CDS       T05000                                 

Gene name
ANKRD53
Definition
(RefSeq) ankyrin repeat domain-containing protein 53
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
pvt  Pogona vitticeps (central bearded dragon)
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pvt03036]
    110079850 (ANKRD53)
Chromosome and associated proteins [BR:pvt03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    110079850 (ANKRD53)
SSDB
Motif
Pfam: Ank_2 Ank_4 Ank Ank_5 Ank_3
Other DBs
NCBI-GeneID: 110079850
NCBI-ProteinID: XP_020650892
Position
Unknown
AA seq 400 aa
MAALHGRLDCIKMLVEKYSVNVDLGSLTGWRAIHLVLSKEAGGMALECLQYLIKKGADVN
VQNHNGVSPLHKAASEGRENCIQPLVDAGADVHAKDADGQEPLDLCKMWGHKATAKCLRS
AIWKREKANFAQEVCRLKEIKMECEARRKEFLIRQQAELDFCNHWAYNEWLAKKGLPLPS
DRILGFLGSRRQSANLWKYVGKTSLPVPVPSPTSLDLEKRPAAQVPRKPHWAWNFSTNPS
SAPATCIFRPNTIRIGVDPEKVPDPDFTSFLFLYKNAFGQPEIQIDNMEKVPFVPDLPFD
VLEKSLYPRARHTRLEVPEDLRPRHLLDLKHRRPPGPEHQWTDQMAVSLRQTLDPAFLGT
LKTHLSSYSDPKWLSPGPALDRAQGSETSSLLSSSSRREE
NT seq 1203 nt   +upstreamnt  +downstreamnt
atggcggctttgcatggccggttggactgcatcaagatgctggtggagaaatacagtgtc
aatgtggacctgggcagtttgacgggctggagggccatccacctggtgctgagcaaggag
gcggggggcatggcgctggagtgcctgcagtacctcatcaagaaaggtgcagacgtcaat
gtgcagaaccacaacggggtgtctccacttcacaaggcagccagtgagggacgtgagaac
tgcatccaaccccttgtcgatgctggtgctgacgtccatgccaaggatgcagacggccag
gagcccctggatctctgcaaaatgtggggccacaaggccaccgcaaagtgcctccgtagt
gccatctggaaaagggagaaggccaactttgcccaggaagtctgcagactgaaggaaatc
aaaatggaatgtgaggcaaggagaaaagagttccttataagacagcaggcggagttggat
ttctgtaaccactgggcgtacaatgagtggttggccaagaagggtttgcctcttccctct
gaccggatcctgggctttctgggaagcaggcgccagtcagcaaacctctggaagtatgtg
gggaaaaccagccttccagtcccagtgccctcccccacatccctagacctggagaaaagg
cctgccgctcaggtgccacgtaagccacattgggcgtggaacttcagcacgaacccttcc
tccgcaccggcgacttgcatcttccggcccaacaccatccggatcggggttgacccagaa
aaggttccagatcccgacttcacctccttcctgtttctttacaagaatgcctttggacag
ccagaaatccagattgacaacatggaaaaagtcccctttgtgccggacctcccctttgac
gtcctggagaagagtctctacccgcgcgcccgacacacgcgcctggaggtcccagaggat
ctcaggccgaggcaccttctggatctgaagcacaggcgccccccaggcccagagcaccaa
tggacagaccagatggcagtgagtctgcggcagacccttgaccctgcctttcttggcacg
ctgaagacccacttgtccagctacagcgaccccaaatggctctctccgggtccggcgttg
gatcgcgcccagggcagcgagacctcttccctcttgagcagtagtagccgccgtgaggag
tag

DBGET integrated database retrieval system