KEGG   Pogona vitticeps (central bearded dragon): 110079935Help
Entry
110079935         CDS       T05000                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD6-like
  KO
K13700  abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
pvt  Pogona vitticeps (central bearded dragon)
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:pvt01002]
    110079935
Enzymes [BR:pvt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     110079935
Peptidases [BR:pvt01002]
 Serine Peptidases
  Family S33
   110079935
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Thioesterase FSH1 DUF1057 DUF2048 Esterase DUF1100 Lipase
Motif
Other DBs
NCBI-GeneID: 110079935
NCBI-ProteinID: XP_020651077
Position
Unknown
AA seq 331 aa AA seqDB search
MITTIMHIILNRLLASFITKYDKLPSIIFRFMTWYKRLKRHVTVKHIDQEGFRFCYFTRG
TPGPQPSILMLHGFSLNKDIWLNILKLFPKDLHVICVDLPGHGDTTRFLGESYTIAAQAK
RMHQFVEWTGLNKKPFHLVGMSMGGMVAGVYAANYPSEVCALSLLCPAGVRNPTETDFFL
RFRELVYSKEASDGTLVSMNEKEAEELLELCLHQPNFIKRQLLKGYLHDRRPHKMFFVTC
FLDVSSAKSRYSLHDNMRRIRAPTQIIWGREDKVFDSSGAEVLATAIPNSKVHILERCGH
FIALERPRKSAKLLLEFYRSICGAAEDKKEA
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgatcacaacaattatgcatatcattctgaacagattattagcgtccttcatcacaaag
tatgacaagttgccttcaattatattcagattcatgacatggtacaaacgtctgaaaagg
catgtgacagtgaaacacattgatcaggagggcttcagattctgttactttacccgaggg
accccaggaccccagccctccattttgatgcttcatggattctcgctcaacaaagacata
tggctaaacatactcaagctctttcctaaggatctccatgtgatctgcgttgacttgcct
ggtcacggagataccacccgcttcttgggagaaagttatactatagcggctcaagccaaa
aggatgcaccagttcgttgaatggactggtctgaacaaaaagccgttccacttggttggc
atgtccatgggcggaatggttgctggggtttatgccgctaattatccatctgaggtctgt
gccttgtccctcctttgcccagccggtgtgaggaatccaacagagactgatttctttctg
cgcttcagagagctggtttattctaaggaagcctctgacggcactcttgtttcaatgaat
gaaaaggaggcggaagagttacttgagctttgtttacatcaacccaatttcatcaagaga
cagctcctaaaaggatatcttcatgatcggagaccacataagatgttttttgttacatgt
tttttagatgtctcaagtgcgaagtccagatacagccttcatgacaacatgaggaggatc
agagctccaacacagatcatctggggaagggaggacaaggtctttgattcttctggtgct
gaagttttagccaccgccattcccaattccaaagtgcatatcttggaacgatgtggacac
ttcatcgcacttgagaggcctcggaagtctgcaaagctcctcttggaattctatcgttcc
atttgtggcgcagcagaagataagaaggaggcgtaa

DBGET integrated database retrieval system