KEGG   Pogona vitticeps (central bearded dragon): 110080003Help
Entry
110080003         CDS       T05000                                 

Gene name
TPP2
Definition
(RefSeq) tripeptidyl-peptidase 2 isoform X1
  KO
K01280  tripeptidyl-peptidase II [EC:3.4.14.10]
Organism
pvt  Pogona vitticeps (central bearded dragon)
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pvt01002]
    110080003 (TPP2)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:pvt03110]
    110080003 (TPP2)
Enzymes [BR:pvt01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.10  tripeptidyl-peptidase II
     110080003 (TPP2)
Peptidases and inhibitors [BR:pvt01002]
 Serine peptidases
  Family S8: subtilisin family
   110080003 (TPP2)
Chaperones and folding catalysts [BR:pvt03110]
 Intramolecular chaperones
  Subtilisin family
   110080003 (TPP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 TPPII TPPII_N
Motif
Other DBs
NCBI-GeneID: 110080003
NCBI-ProteinID: XP_020651213
Position
Unknown
AA seq 1262 aa AA seqDB search
MAAGAGEEQFPFQGLLPKKETGAASFLARYPEYDGRGVLMAILDTGVDPGAPGMQITTDG
KPKIIDIIDTTGSGDVNTSTVTEPKDGEIIGLSGRTLKVPTDWINPSGKYHIGLKNGYDI
YPKALKERIQKERKEKLWDPAHRLALAEACRKQEEFEAAHSTPSQESKLMKEEFQSQVEL
LNSFEKKYSDPGPVYDCLVWHDGETWRACIDSSETGDFSNCTVLRNYKEGQEYGSFGTSE
MLNYSVNIYDDGNLLSIVTSGGAHGTHVACIAAGYFPDEPDRNGVAPGAQILAIKIGDTR
LSTMETGTGLIRAMIETIKYKCDLVNYSYGEATHWPNAGRICEVINEAVWKHNVIYVSSA
GNNGPCLSTVGCPGGTTCSVIGVGAYVSPDMMVAEYSLREKLPANQYTWSSRGPSTDGAL
GVSISAPGGAIASVPNWTLRGTQLMNGTSMSSPNACGGIALVLSGLKANNVHYTVHSVRR
ALENTATKVENIHVFAQGHGIIQVDKAYDYLIQNTSFANSIGFTVSVGNNRGIYLRDPVQ
VAAPSDHGVGIEPFFPENTENTDRISLQLHLALTSSASWVQCPTHLELMNQCRHINIRVD
PRGLREGVHYTEVCGYEISMPNAGPLFRVPVTVVKTAKTDEASCYDLKFTSVHFKPGEIQ
RHFIEVPSGATWAEVTVCSSSSDVTAKFVLHAVQLVKQKAYRSHEFYKFSSIPEKGSITE
AFPVLGGKTIEFCIARWWASLNDVSIDYTISFHGIVCTASQLNIHASEGIVRFDVLSTLR
YEDIAPCINLKNWVQTLRPLSTKIKPLGSRDVLPNNRQLYELILTYSFHQPKSGEVTPSC
PLLCELLYESEYDSQLWIIFDQNKKQMGSGDAYPHQYSVKLEKGDYTVRLQIRHEQSSEL
DRLKDLPFIISHRLSSALSLDIYESHSQALLGKKKANSMSLPPKHSQPFFVTSLPDDKVP
KGAGPGCYLGGSLTLSKTELGKKAGQSAAKRQGKFKKDVISVHYHLIPSPTKNKNGSKEK
EKDPEKEKDAKEEFIEALRDLKIQWMTKLDTNDIYNELKEAFPNHLPLYVARLHQLDSEK
ERMKRLNEVVEAANTVISHIDQTALAIYLGMKTDPRPDAATIKNEMDKQKSTLVDALCRK
GSALADQLLQLQAQEGAVSGETESKDEGQDSAFEALTETFWETTKWTDVTDTKVLPFAYK
HALVNKMYGRGLKFATKLAEEKPTKENLKNSIQLMKFLGWTHCASFTENWLPVMYPPDYC
VF
NT seq 3789 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgggggctggggaagagcagttcccgttccaagggctcctgcctaagaaggag
accggcgctgcttccttcctcgcccggtacccggagtatgacggacggggagtcttaatg
gccattttggacacgggtgtggaccccggagcgccgggcatgcagattacaactgatgga
aaacccaagataattgacataatagatacaacaggcagtggtgatgtaaacacctcaact
gttacagaaccaaaagatggagaaatcattggtctttcaggaagaactctgaaggtccca
acagattggataaatccttctggaaagtatcacattggcttaaaaaatggttatgacatc
tatcctaaagcgcttaaagaaagaatccagaaagaacgcaaggagaagctttgggatcct
gctcacagattggcactagcagaagcttgtaggaaacaagaggaatttgaagccgctcac
agcactccatcacaggaaagcaaactaatgaaggaagagtttcaaagtcaagtggaatta
ctaaattcttttgagaaaaaatacagtgatcctggcccagtatatgattgcttggtttgg
catgatggtgaaacctggagagcttgcatagattcaagtgaaacaggtgatttttctaac
tgcactgttctgcggaactacaaagaaggtcaagaatatggatcttttggcacatcagag
atgttgaattattctgtcaatatttatgatgatgggaaccttctctcaattgtgaccagt
ggaggagcacatggaacacatgttgcttgcatagctgctggatatttcccagatgaacct
gatcggaatggtgtggccccaggtgcacaaattcttgcaataaagattggtgatacaaga
ttgagcaccatggaaacaggcactggccttataagagctatgatagaaacaataaaatac
aagtgtgaccttgtcaactatagttatggagaagcaactcactggccaaatgctgggaga
atatgtgaagtaattaatgaagcagtatggaaacataatgtaatctatgtttcaagcgct
gggaacaatggcccttgtttgtctactgttggatgtccaggtggaactacatgtagtgtg
attggtgttggtgcttacgtatcacctgacatgatggttgctgagtactcactgagagag
aagctacctgcaaatcagtacacttggtcatctcgagggcctagtactgatggagccctg
ggagtgagtatcagtgcccctggaggtgctattgcatctgtcccaaactggaccttacga
gggacgcagcttatgaacggtacctcgatgtcttcacctaatgcatgtggtggcattgcg
ttggtactgtcaggtctcaaggctaataatgtgcattacactgttcattccgtcaggaga
gctctagaaaatactgcaacaaaagtggaaaacatacatgtatttgcccaggggcatggt
attattcaggttgataaagcctatgactacctcattcagaatacatcatttgctaacagt
atcggtttcactgttagtgttggcaacaaccgtggtatctacctcagagatccagttcag
gtagctgcaccttctgaccatggtgttggcatagaaccgttcttccctgagaatacagaa
aatactgacagaatatccctccagttgcatctggctttaacttcaagtgcatcctgggtt
cagtgccctactcatctggagctcatgaatcagtgtaggcatattaacattcgtgtggac
ccacgtggcctacgagaaggagttcactatacagaggtgtgtggttatgaaatatcaatg
cctaatgcaggtcctttgtttagagttccagtaactgtggttaaaacggcaaagacagat
gaagcttcatgctatgatctcaaatttactagtgttcattttaaacctggtgaaatccaa
aggcattttattgaagttccttctggagcaacatgggctgaagtaacagtatgctcatca
tcatcagatgtgactgccaagtttgtcctccatgctgttcagctagtaaagcaaaaggca
taccgaagccatgagttctacaagttttcttcaataccagaaaaaggatcaattacggaa
gcatttcctgttttaggtggaaagacaattgaattctgtattgcccgttggtgggcaagc
ctcaatgatgtcagcattgattacacaatttccttccatggcatagtttgcactgcttct
cagttaaatattcatgcttctgaaggcattgtgcgctttgatgttctatcaacgctgaga
tatgaagatattgctccttgcataaatctcaaaaattgggttcaaacactgagaccgctg
agtactaaaataaagccactaggatcacgagatgttttgccaaataatcgacaattgtat
gagctgattttgacatatagcttccatcagccaaagagtggggaagttacaccaagttgt
cctctgctctgtgaactgttgtatgaatctgaatacgacagccaattgtggattatcttt
gaccagaataaaaaacagatggggtcaggagatgcctatcctcaccagtattcagtgaaa
ctggagaaaggagattatacagttcggctacagatccgtcatgagcagagcagtgaactt
gatcgtctcaaagatcttccatttatcatctctcatagactgtctagtgcactgagttta
gatatttatgaaagccatagccaagctcttctagggaaaaagaaggcaaacagcatgtcc
ttgccaccgaaacacagccagcccttttttgttacatctttaccagatgacaaagtgcct
aaaggagcaggtccaggttgttaccttggaggatcactgaccctttcaaagacagagctt
ggaaagaaagcggggcagtctgcagcaaagcgacaaggaaagtttaaaaaggatgtaatt
tcagttcactatcatctaattccatcaccaacaaaaaataagaatggcagcaaggaaaaa
gagaaggatccagagaaagaaaaagatgcaaaagaagaatttattgaggctttaagagac
ctgaaaatacaatggatgactaagcttgatactaatgacatctacaatgaactgaaagaa
gcatttcctaatcatctccccttgtatgttgcgagacttcatcagttggattctgaaaag
gaacgaatgaaaagactgaacgaagttgttgaggctgccaatacagttatctcgcatatc
gatcaaacagcccttgccatttatcttggcatgaagactgatcctaggcctgacgctgct
actattaaaaatgaaatggacaagcagaaatcgacattagtcgatgctctctgtcggaaa
ggaagtgccttggcagaccagctcctgcagttgcaggcccaagaaggggctgtatctggt
gagacagaaagtaaggacgaaggtcaggatagtgccttcgaagcactgactgaaacattc
tgggagacaacaaaatggacggacgtgactgataccaaggttttaccgtttgcctataag
catgcactagtaaataaaatgtatggtagaggcctcaaatttgcaacaaaacttgcagag
gagaaacctaccaaagaaaacttgaagaattctatacagctaatgaagttccttggctgg
actcactgtgcatctttcaccgaaaactggcttcctgttatgtatccacctgattattgt
gttttttga

DBGET integrated database retrieval system