KEGG   Pogona vitticeps (central bearded dragon): 110081228Help
Entry
110081228         CDS       T05000                                 

Gene name
CAMK1D
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type 1D
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
pvt  Pogona vitticeps (central bearded dragon)
Pathway
pvt04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    110081228 (CAMK1D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pvt01001]
    110081228 (CAMK1D)
Enzymes [BR:pvt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     110081228 (CAMK1D)
Protein kinases [BR:pvt01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   110081228 (CAMK1D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo Pkinase_fungal RIO1 APH 5_nucleotid Tyrosinase Pox_ser-thr_kin
Motif
Other DBs
NCBI-GeneID: 110081228
NCBI-ProteinID: XP_020653437
Position
Unknown
AA seq 392 aa AA seqDB search
MAQENGEDSSSWKKQAGDINKIFEFKETLGTGAFSEVVLAEHRATGKLFAVKCIPKKALK
GKESSIENEIAVLRKIKHENIVALEDIYESPSHLYLVMQLVSGGELFDRIVEKGFYTEKD
ASTLIRQVLDAVYYLHRMGIVHRDLKPENLLYYSQDEESKIMISDFGLSKMEGKGDVMST
ACGTPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDSKLFEQILKAEYEF
DSPYWDDISDSAKDFIRNLMEKDPNKRYTCEQAARHPWIAGDTALNKNIHESVSAQIRKN
FAKSKWRQAFNATAVVRHMRRLHLGSSLDSSNVSVSSSLSLAKPLPDGTARKDCMSPSTL
CSFASSASTGISAVGERRPRQTTVTTVHTGSK
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggcccaggagaacggcgaggacagctcctcctggaagaagcaagccggcgacatcaac
aagatcttcgagttcaaggagaccttggggactggtgccttttctgaagtggttttagca
gaacacagggctactgggaaactatttgctgtcaagtgcataccaaagaaagcactgaaa
ggaaaggaaagcagcatagagaatgaaattgcagttctcagaaagatcaagcatgaaaat
attgttgcacttgaagacatctatgagagtccaagccacttgtatctcgtcatgcaacta
gtatctggaggtgagctatttgaccgcattgtggagaagggattttacactgagaaagat
gcaagcactttaatacggcaagtcttggatgctgtgtattatctccacagaatgggcatt
gttcacagagacctcaagcctgaaaacctgttgtactacagccaggatgaagaatctaaa
atcatgattagtgattttgggctttcaaaaatggagggtaaaggtgatgtcatgtccaca
gcttgtggcaccccaggatatgttgctcctgaagtgcttgcccagaaaccctacagcaaa
gcagtggactgttggtccattggagttattgcatatattctgctctgtggttatccacct
ttctatgatgaaaatgactccaagctttttgagcaaattctcaaggcagaatatgaattt
gactctccatattgggatgatatatctgactctgcaaaagattttattcggaatttgatg
gaaaaagatcccaataaaagatatacatgtgagcaagcagcacggcatccatggattgct
ggagacaccgccctcaataaaaatatccatgaatctgtcagtgctcagatacgcaagaat
tttgcaaaaagcaaatggaggcaagcttttaatgctacagcagttgtgagacacatgaga
aggttacatcttggcagcagtttggacagttcaaatgtaagcgtatcaagctccctcagt
ttggccaaacctttacctgacggaacagccaggaaagactgtatgtccccatccactctc
tgtagttttgcatcatcagcatcaactggcatctcagctgtaggagagaggagaccaagg
cagaccacagtcacaacagtgcacacggggagcaagtaa

DBGET integrated database retrieval system