KEGG   Pogona vitticeps (central bearded dragon): 110082845
Entry
110082845         CDS       T05000                                 

Gene name
AKAP5
Definition
(RefSeq) A-kinase anchor protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
pvt  Pogona vitticeps (central bearded dragon)
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pvt01009]
    110082845 (AKAP5)
Protein phosphatases and associated proteins [BR:pvt01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     110082845 (AKAP5)
SSDB
Motif
Pfam: WSK gpD
Other DBs
NCBI-GeneID: 110082845
NCBI-ProteinID: XP_020656408
Position
Unknown
AA seq 483 aa
MEETAKGIQTENIQTTGASNTEKNIMTDESPAKKASIFCFKKRRKAGEKITEKDDDCVSL
SLKPANQDSNLGGIEAEVSNSLWFAFKRLVTLRRRSRSSLKKPTQPGSSVALEIQAEDSA
TLHCPKEHTSLKMPCLRFSRSRKKPSRLEITEELGEKTDETTSILNKKSNSESETMGLEG
PLSTEQSPRRVLEERESDGEAVKNVDNVGVPARENEFAVEPRPGRDCYADSVVQSEIIHS
EKALETEQEKQIFQLHQGSLYGNPEEVESEKFDFKVDLGPLLPQGLSETEQKILEEDAKD
IQATEAKLEPVDGVVDLVDGRISGKGSNAVEVMMHAIPSTMEDEVSVCSDEEGRSEENRP
MMMPAVGIVITITEAEEFQEEEEPAPVYEPFSFPQASKKKGKKKANKSANSGVEGSGQTW
EGKTPPKVPSPLGANDQERRTSEQYEVLLIETAASLVKAAIQSSIEQVLNEVALEQNKQN
SFL
NT seq 1452 nt   +upstreamnt  +downstreamnt
atggaggaaacagctaaaggaattcagactgagaacatacaaaccacaggagcctcaaat
acagaaaaaaacatcatgacagacgagagcccagccaaaaaggcctccatcttttgcttc
aagaaaaggaggaaagcgggtgaaaagataacagagaaagatgacgattgtgtatcgctt
tccttaaagcctgcgaaccaggactccaaccttggaggcattgaggcagaagtttcaaat
tcgctgtggtttgctttcaaacgcctagtaacattgagaaggcgatcccggtcttctctg
aagaagcctacccagccgggttcctctgtagcgctggagattcaggctgaagattctgcc
acactacactgccctaaggagcacaccagccttaaaatgccttgcttgaggttctccaga
agcaggaaaaagccaagccgtttggaaataaccgaggaactgggggagaaaacagatgaa
acaaccagcatcctgaataaaaaaagtaacagtgaatctgaaacgatgggcctggaagga
ccactgagcactgagcagtcccccagaagagttcttgaggagagagaaagtgacggtgaa
gccgttaaaaacgttgataatgtgggcgtgcctgctagggagaacgaatttgcggtagag
ccgaggcctggtcgtgattgttacgcagactctgtggttcagtcagaaataatccactct
gagaaagcccttgaaacggaacaggagaaacagatctttcagctgcaccagggaagtctc
tacggaaacccagaagaagtagaatctgagaaatttgatttcaaggttgatctaggccct
ctccttcctcagggcttgtcagaaactgagcaaaaaatcttggaagaagacgccaaggac
atccaggccacagaagctaagttagaaccagtggacggggttgttgatcttgtagacggc
aggatcagtggcaagggcagtaatgctgttgaagtgatgatgcacgccatcccgtcaacg
atggaagacgaggtttccgtttgttccgacgaggaagggagaagtgaagaaaacagaccc
atgatgatgcccgcagtaggcattgtgatcacaatcacggaagcagaagaattccaagag
gaggaagagcccgccccggtttatgaacctttttcattcccacaagccagcaaaaagaaa
gggaagaaaaaagcaaacaaaagcgcaaactctggcgtagagggttccggtcagacgtgg
gaaggaaaaacacctcccaaggtcccatcgccattaggcgccaacgaccaggagcgccgg
acttcagaacaatacgaagtgcttctgattgaaaccgctgcgtctctggtgaaggcagcc
attcagtcgtccatcgaacaggtccttaacgaagtggctttggagcaaaataaacaaaac
agctttctgtga

DBGET integrated database retrieval system