KEGG   Pogona vitticeps (central bearded dragon): 110083113Help
Entry
110083113         CDS       T05000                                 

Gene name
MINPP1
Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
pvt  Pogona vitticeps (central bearded dragon)
Pathway
pvt00010  Glycolysis / Gluconeogenesis
pvt00562  Inositol phosphate metabolism
pvt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110083113 (MINPP1)
   00562 Inositol phosphate metabolism
    110083113 (MINPP1)
Enzymes [BR:pvt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     110083113 (MINPP1)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     110083113 (MINPP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 DUF4708
Motif
Other DBs
NCBI-GeneID: 110083113
NCBI-ProteinID: XP_020656939
Position
Unknown
AA seq 468 aa AA seqDB search
MHLSAGGLLLSVLLVLAEGPAEGNAEAAEQLSPYFGTKSRYEELHPHLLEDPLSLGPPQP
GFPLPPASCTPLKLIGVFRHGPRFPTRKQIEKLGRLHSRVLQRNSSSPTCPAVERLSRWN
MWFRPDMDGKLASRGRRDMEMLAGRLAARFPSLLGPKRRFAFVSSSKHRCVDSTNAFREG
LRQALYGQQAAAEPNATMTETLEINDKLMRFFDHCEKFVRDIEDNNTAMHEVDAFKEGPE
MKMIVEKIADTLCLPVSDLNADLIQTAFFTCSFGLTIRNVNSPWCSLFSTEDAKVLEYLN
DLKQYWKRAFGYDINSRSSCNLFQDIFKHLHQAVIESKSSKPISSPVILQFGHAETLQPL
LALMGYFKDDEPLKAHNYHRQMHRKYRSGRIVPYASNLLFLLYHCDQTSFPEEEYKVQIL
LNERLLQFPHSGETVSLYTSLKNHYKDLLQNCNFAEVCAMPKNTTWID
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgcacctcagcgcgggaggtctcctcttatcggtcctcctcgtcttagcggagggaccc
gctgaggggaatgccgaggcggcagagcagctgagcccctatttcggcactaaatcccgc
tatgaagagctccacccgcacctgctggaggacccgctgtccctcgggcccccgcagccg
ggctttccgctgccgccggcctcctgtacacctcttaagctcatcggcgtcttccgccac
ggcccccgctttcccacccgcaagcagatcgagaagctgggccgcctccacagccgcgtc
ctccagaggaacagcagcagcccgacctgcccggctgtcgagcgcttgtcgcgctggaat
atgtggttccggcccgacatggacggcaaactggcctcccgcgggcgccgcgacatggag
atgctggccgggcgcctcgccgcccgcttccccagcctcctgggtccgaaacgccgcttc
gcctttgtcagtagctccaaacaccggtgcgtggacagcaccaacgccttccgggaaggg
ctccggcaggccctctatgggcagcaggccgcggccgaaccgaatgctacaatgacagaa
acacttgaaatcaatgacaaactaatgagatttttcgatcactgtgaaaaatttgtaaga
gatatagaagacaataatacagctatgcatgaagttgatgccttcaaggaaggtcctgag
atgaaaatgatagtggagaaaattgcagatacactgtgtctaccagtaagtgacctaaat
gcagatttgattcagacagcatttttcacttgctcatttgggctaactataagaaacgtc
aattccccctggtgctcactctttagtacagaagatgccaaggtacttgaatatctgaat
gatttaaagcagtattggaaaagagcttttggatatgatatcaacagtcgttccagctgc
aatcttttccaagatattttcaaacatttacaccaagctgttatagagagtaaaagttca
aagcctatttcttcacctgtgatcctccagtttgggcatgcagagacccttcaacccctc
cttgctctgatgggttacttcaaagatgacgagcctcttaaagcacacaactaccataga
cagatgcaccggaagtatcgtagcggtcgcatcgtcccttatgcctcaaacctgttgttt
ttgctgtatcattgcgatcaaaccagttttccagaggaggaatacaaagttcagatattg
ctcaatgaaaggctgctgcagtttccacactcaggggagactgtttccttgtacaccagt
ctgaaaaaccactataaagacctgcttcagaactgcaattttgctgaagtgtgtgctatg
ccaaagaacactacttggattgattaa

DBGET integrated database retrieval system