KEGG   Pogona vitticeps (central bearded dragon): 110083124Help
Entry
110083124         CDS       T05000                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
pvt  Pogona vitticeps (central bearded dragon)
Pathway
pvt00010  Glycolysis / Gluconeogenesis
pvt00562  Inositol phosphate metabolism
pvt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110083124
   00562 Inositol phosphate metabolism
    110083124
Enzymes [BR:pvt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     110083124
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     110083124
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 DUF4708 DUF1722
Motif
Other DBs
NCBI-GeneID: 110083124
NCBI-ProteinID: XP_020656965
Position
Unknown
AA seq 472 aa AA seqDB search
MLPCGQRHCHSRAEWLFLSVLLVLAEGLAEGNAEAAEQLSPYFGTKSRYEELHPHLLEDP
LSLGPPQPGFPLPPASCTPLKLIGVFRHGTRDPTREQREKLGRLHSLVLQRNSSSPTCPA
VERLSRWNMWFRPDTDGMLAARGHYDMEMLAGRLAARFPRLVEPKSRFAFVSSSKQRCID
SSTAFRKGLRRALHGHHSTAKTNVTLTETFEIKDRLMRFFDYCEKFIKDVEDNNTAMFEV
NAFKKGPEMKKIAEKVANKLCLPADDLNADLLQTAFFTCAYGLTIKNINSPWCSLFNIED
AKVLEYLNDLKQYWKRAYGYPIDSRSSCNLFQYIFKHLDQAVVESKSSKPISSPVILQFG
HAETLQPLIALMGYFKDKEHLTAKNYYRQMHRKYRSGRIVPYAANLLFLLYYCDPEEKYK
VQILLNEWVLQFPFSEDTASLYTSLKNHYKDFLQNCNFAEVCAVSKNTSRSG
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgttgccctgcgggcagcgccattgtcactccagggcggaatggctcttcttatcggtc
ctcctcgtcttagcggagggactcgctgaggggaatgccgaggcggcagagcagctgagc
ccctatttcggcaccaaatcccgctatgaagagctccacccgcacctgctggaggacccg
ctgtccctcgggcccccgcagccgggctttccgctgccgccggcctcctgtacgcctctt
aagctcatcggcgtcttccgccacggcacccgcgaccccacgagggagcagagggagaag
ctgggccgcctccacagcctcgtcctccagaggaacagcagcagcccgacctgcccggct
gtcgagcgcttgtcgcgctggaatatgtggttccgtcccgacacggatgggatgctggcg
gcccgtgggcactacgacatggagatgctggccgggcgcctcgccgcccgcttcccccgc
ctcgtagagccgaaaagccgcttcgcttttgttagcagctctaaacagcggtgcatcgat
agtagcactgccttccggaaaggactccgacgggctctccacgggcaccactccacggcc
aaaacaaatgtaacattgacagaaacatttgaaattaaggacagactaatgagatttttc
gattactgtgaaaaatttataaaagatgtagaagacaataatacagccatgtttgaggtc
aatgccttcaagaaaggtcctgaaatgaagaagatagcggaaaaagttgcaaataaatta
tgtctaccagcagatgatctaaacgcagatttgcttcagacagcatttttcacttgtgca
tatgggttaactataaaaaacatcaactccccctggtgttcactcttcaatatagaagat
gccaaggtacttgaatatctgaatgatctaaagcagtactggaagagagcttacggatat
cctattgacagtcgttccagctgtaatcttttccaatatattttcaaacatttggaccaa
gctgttgtggagagtaaaagttcaaagcctatttcttcacctgtgatcctccagtttggg
catgcagagacccttcaacctctcattgctctaatgggctacttcaaagataaggaacat
cttacagctaagaactactatagacagatgcaccggaagtatcgtagtggtcggattgtc
ccttatgccgcaaatcttttgtttctgctttattattgtgatccagaggagaagtacaaa
gttcagatactgctcaatgagtgggtgttgcagtttccgttctcagaggatactgcttcc
ctatacactagcctgaaaaaccactataaagatttccttcaaaattgcaactttgctgaa
gtgtgtgcagtgtcaaagaacacttctaggtctggttaa

DBGET integrated database retrieval system