KEGG   Pogona vitticeps (central bearded dragon): 110083316Help
Entry
110083316         CDS       T05000                                 

Gene name
SUCLG2
Definition
(RefSeq) succinate--CoA ligase [GDP-forming] subunit beta, mitochondrial isoform X1
  KO
K01900  succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5]
Organism
pvt  Pogona vitticeps (central bearded dragon)
Pathway
pvt00020  Citrate cycle (TCA cycle)
pvt00640  Propanoate metabolism
pvt01100  Metabolic pathways
pvt01200  Carbon metabolism
Module
pvt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pvt_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    110083316 (SUCLG2)
   00640 Propanoate metabolism
    110083316 (SUCLG2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pvt04147]
    110083316 (SUCLG2)
Enzymes [BR:pvt01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     110083316 (SUCLG2)
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     110083316 (SUCLG2)
Exosome [BR:pvt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110083316 (SUCLG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-GeneID: 110083316
NCBI-ProteinID: XP_020657339
Position
Unknown
AA seq 434 aa AA seqDB search
MVKDTPSFGTVFKPGSHGFLGAPKQIMVARAVQWAPRRWLNLQEYQSKKLMADHGVTVQR
FFVADTASEALEAANRLKATEIVLKAQILAGGRGKGVFSSGLKGGVHLTKDPNVVRQLAE
QMIGYNLVTKQTPKGGVKVKKVMVAEALDISRETYFAVLMDRACNGPVLVGSPQGGVDIE
EVAAKTPELIFKEEIDIFEGVKDTQALRMAENLGFKGPLQQQAADQIKKLYNLFLKIDAT
QVEVNPFGETPEGQVVCFDAKINFDDNAEFRQKEIFAMDDKSENEPIENEAARYDLKYIG
MDGNIACFVNGAGLAMATCDIISLNGGKPANFLDLGGGVKEAQVYQAFKLLTADPKVEAI
LVNIFGGIVNCAIIANGITKACRELELKVPLVVRLEGTNVHEAQRILNESGLPIMSACDL
EDAARKAVASVSKK
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaagacaccccctccttcggaactgtatttaagccaggctcccatggtttcttg
ggtgcaccaaaacaaatcatggtagcgagggctgttcaatgggcccccaggcgatggcta
aacctgcaggaataccagagtaagaagctgatggctgatcacggggtcacagttcagaga
ttctttgtagctgacactgccagtgaagctcttgaggctgcaaacaggctaaaggctaca
gaaatcgtgttgaaggctcagatcctagctggaggaagaggaaaaggtgttttcagcagc
ggtctcaagggaggtgtgcacctaaccaaggaccctaatgtggtgcgacagcttgctgaa
cagatgattggatacaatcttgtgacaaagcaaacaccgaagggaggtgttaaagttaag
aaggttatggtggcagaagcactcgacatttccagagaaacctattttgcagtgttaatg
gatcgagcttgtaacggacctgttctggttggcagcccgcaaggcggggttgatattgaa
gaagtggctgccaaaacccctgaactcatcttcaaggaggaaatagatatttttgaaggt
gtaaaagacactcaagcacttcggatggcagaaaatttaggattcaaggggcctctgcaa
cagcaggctgcagatcaaattaagaagctctacaatcttttcctgaaaattgatgccact
caagtagaggtgaatccctttggtgaaactccagaaggacaagttgtatgctttgatgcc
aagatcaactttgatgacaatgctgagttcaggcagaaagagatatttgccatggatgac
aagtctgagaatgaaccaatagaaaatgaagctgcccgctatgacttaaaatacataggg
atggatggaaacatcgcgtgttttgtcaatggcgctgggcttgctatggcaacctgtgat
ataatttcccttaatggtggaaagcctgccaatttcctagatcttggtggaggcgtgaag
gaagcacaagtgtatcaagcattcaaattgctcactgcggatccaaaggttgaagcaatt
ctggtcaatatttttggtgggattgttaattgtgccattatagccaatggcatcaccaaa
gcttgccgagagcttgaactcaaagtgcctctagtggtcagacttgaagggacaaacgtt
catgaagcccagcgcattttgaatgagagtggactcccaatcatgtctgcatgtgacctt
gaagatgctgccaggaaggcagtggccagtgtgtcaaagaaataa

DBGET integrated database retrieval system