KEGG   Pogona vitticeps (central bearded dragon): 110083829Help
Entry
110083829         CDS       T05000                                 

Gene name
ACSL1
Definition
(RefSeq) long-chain-fatty-acid--CoA ligase 1 isoform X1
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
pvt  Pogona vitticeps (central bearded dragon)
Pathway
pvt00061  Fatty acid biosynthesis
pvt00071  Fatty acid degradation
pvt01100  Metabolic pathways
pvt01212  Fatty acid metabolism
pvt03320  PPAR signaling pathway
pvt04146  Peroxisome
pvt04216  Ferroptosis
pvt04920  Adipocytokine signaling pathway
Module
pvt_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    110083829 (ACSL1)
   00071 Fatty acid degradation
    110083829 (ACSL1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    110083829 (ACSL1)
  09143 Cell growth and death
   04216 Ferroptosis
    110083829 (ACSL1)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    110083829 (ACSL1)
   03320 PPAR signaling pathway
    110083829 (ACSL1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pvt01004]
    110083829 (ACSL1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pvt04147]
    110083829 (ACSL1)
Enzymes [BR:pvt01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     110083829 (ACSL1)
Lipid biosynthesis proteins [BR:pvt01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   110083829 (ACSL1)
Exosome [BR:pvt04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   110083829 (ACSL1)
  Exosomal proteins of breast cancer cells
   110083829 (ACSL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C GSG-1
Motif
Other DBs
NCBI-GeneID: 110083829
NCBI-ProteinID: XP_020658289
Position
Unknown
AA seq 698 aa AA seqDB search
MQAHELFRHLRMPELGDVRQYVRTLPTNTLMGFGAFAALTTYWYATRPKALKPPCDLAMQ
SVEVEGEEFARRSSLLESNEPIMYYYDDVRTVYDVFQRGMHLSNNGPCLGVRKPNQPYEW
ISYKEVAERAECIGSELLNRGFKPSPDQFIGIFSQNRPEWVIIEQGCYTYSIAAVPLYDT
LGTEAITYIVNKADIALVFCDKPEKAKLLLDSIEKGEVSVLKTIVIMDPFDTDLVARGQK
SGVDIITLKEMEALGRAHKHKPVLPKPEDLAIVCFTSGTTGNPKGAMLTHQNIVSNMSAF
VKATEKAVFPSTEDILISFLPLAHMFERVVECVILCHGARIGFFQGDIRLLMDDLKTLQP
TIFPVVPRLLNRMFDKIFGQANTSFKRWILDFASKRKEAELRSGIIRNNSLWDKMIFRKI
QANLGGKVRLMVTGAAPVSANVLTFLRAALGCQFYEGYGQTECTAGCSITIPGDWTAGHV
GAPMPCNLVKLVDVEEMNYFAAKGEGEVCVKGPNVFQGYLKDPEKTAEVLDKDGWLHTGD
VGKWLPNGTLKIIDRKKHIFKLAQGEYIAPEKIENIYLRSEPVAQVFVHGESLQAFLIAI
VVPDPEVLPTWAKKKGLVGSYEELCRNKDLKKLILEDMVKVGKDFGLKSFEQIKAITLYP
EMFSVENGLLTPTLKAKRLELRKYFRSQIEELYANTQM
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atgcaagctcatgaattgttcaggcatctgcgaatgccagaactcggtgatgtaaggcaa
tacgtgcgcactcttccaacaaacactctgatgggattcggtgctttcgcagctctcaca
acttactggtacgccacaagaccaaaagctctgaagccaccatgtgatttagcaatgcaa
tctgtggaggtagagggtgaagagtttgcacgtaggtcgtcattgcttgagagcaacgag
ccaataatgtactactatgatgatgtgagaacagtttatgatgtcttccaaaggggaatg
catctgtcaaacaatggtccttgcttgggtgtaaggaaaccaaatcagccatatgagtgg
atctcttacaaagaggttgcagaaagagcagaatgtattggttcagaacttctcaacaga
ggtttcaaaccatctcctgaccagttcattggaatcttctcacagaacaggcctgagtgg
gttattattgaacaaggatgttacacttactctatagcagctgtacccctgtatgatacc
cttggaacagaagctatcacttatattgtaaataaagctgacatagctttggttttttgt
gataagcccgaaaaagctaagcttctgctggatagcatagagaagggagaagtgtcagtc
ctcaaaactattgtgatcatggacccctttgacactgatcttgtggctcgtgggcagaag
tctggagtggacatcatcactctgaaagaaatggaggcattgggaagagcccacaaacac
aaacccgtacttccaaaaccagaagacctagccatagtctgtttcaccagtggaactaca
ggaaatccaaaaggagcaatgcttactcaccaaaatatagtgagcaatatgtcagcattt
gtgaaagctacagagaaagcagtttttccttctacagaagatatcttaatctctttcttg
cccctggcccatatgtttgaaagagttgtggagtgtgtgattctctgccatggagctcga
ataggatttttccagggagacatcaggctgcttatggatgacttaaaaacattgcagcct
acaatatttccagttgtgccaaggctgctgaacagaatgtttgacaaaatttttggccaa
gcaaacacttcatttaagcggtggatattagactttgcttccaagaggaaagaggcagaa
cttagaagtggaataattcggaataatagcctgtgggataaaatgattttccgtaaaata
caggcaaacctgggaggaaaagtcaggctaatggttacaggggcagctcctgtttctgca
aatgtactgacgttcctaagagcagctcttggttgtcagttctatgaaggttatggacag
acagaatgcacagctggatgttccataacaatacctggtgactggactgctggtcacgtt
ggtgccccaatgccttgcaatctcgtaaagcttgttgatgtagaagaaatgaattatttt
gctgctaaaggagagggtgaggtttgtgtgaaagggcccaatgtattccaaggctacctg
aaggaccccgaaaaaactgcagaagtgcttgacaaagatggttggctacacactggagat
gttgggaaatggttaccaaatggtactttgaaaataattgacaggaaaaaacacatattc
aaacttgcacagggagaatatatagccccagaaaaaatagagaatatttatttgaggagt
gaacctgttgcccaggtatttgtccatggtgaaagcttgcaggccttcctaatagcaata
gtggtaccagatccagaagtgttacccacctgggctaagaaaaaaggactggtggggtca
tatgaagaactatgcagaaacaaagaccttaaaaaactcattctggaagatatggtgaaa
gttggaaaagattttggcttgaagtcatttgaacagatcaaagccatcactctttaccct
gaaatgttctctgtcgagaatggcctactcacaccaacattaaaggcgaagagacttgag
cttcgcaagtacttcaggtcccaaatagaagaactctatgctaatacccagatgtaa

DBGET integrated database retrieval system