KEGG   Pogona vitticeps (central bearded dragon): 110084610Help
Entry
110084610         CDS       T05000                                 

Gene name
TTN
Definition
(RefSeq) titin
  KO
K12567  titin [EC:2.7.11.1]
Organism
pvt  Pogona vitticeps (central bearded dragon)
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pvt01001]
    110084610 (TTN)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pvt04131]
    110084610 (TTN)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pvt04812]
    110084610 (TTN)
   04147 Exosome [BR:pvt04147]
    110084610 (TTN)
Enzymes [BR:pvt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110084610 (TTN)
Protein kinases [BR:pvt01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   110084610 (TTN)
Membrane trafficking [BR:pvt04131]
 Others
  Actin-binding proteins
   Others
    110084610 (TTN)
Cytoskeleton proteins [BR:pvt04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     110084610 (TTN)
Exosome [BR:pvt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110084610 (TTN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set fn3 Ig_3 ig Ig_2 V-set Pur_ac_phosph_N fn3_2 C2-set_2 Ig_6 Receptor_2B4 Tissue_fac Pkinase C1-set fn3_4 Titin_Z Ig_5 Pkinase_Tyr Izumo-Ig DUF2369 Ig_4 Ig_C17orf99 PPAK THB
Motif
Other DBs
NCBI-GeneID: 110084610
NCBI-ProteinID: XP_020659745
Position
Unknown
AA seq 35430 aa AA seqDB search
MTTKAPTFTQPLQSVVALEGSAATFEAHISGSPVPEVSWYRDGQVLSAATLPGVQISFSD
GRAKLVIPAVTAANSGRYTLQATNGSGQATSTAELLVTAETAPPNFSQRLQSMTARQGSQ
VRLDVRVTGIPTPVVKFYRDGAEIQSSPDFQILHEGDLYSLIIAEAYPEDSGTYSVNATN
SVGRATSTAELLIQGEEEAVPAKKTKTIVSTAQITQTTQRQARIEKKIEAHFDARTLATA
EMVIDSVTGQQLPHKAPPRMPPRPASMSPTPPIIAAKVQMARQQSPSPVRQSPSPVRHVR
APTPSPVRSVSPAAAAAAAGRLSVSTSPIRSVKSPIMVRKAQAGAAAVGAEVLPPWKQEG
YVATSETRMQDTRVTTTQMRTEERWEGRYGIQEQITVSGAAAAAAEAAVGVSAAAAASAA
AAAAITTEDFGKSAAVATVVAAVDMARVREPLPSAVEQAAKRTAVTAVHIQPVQEQIKKE
ATIVVTSATGKAREQEVISRTREGVATRQEQIHITQEKIKKEPVKVPVPKVIIAADTIKE
QEQISRAREEISTRREEIHIAHEKTRKEVVKPVKPSVPKVVITTDKAKVPTTVVKATEGI
ATKQEQQAYLIQEKIRKEAEKKIIVPAVVAVEKRREQEKVSRTREEVAAKREQIHLAHDQ
IAVGKRAEAVATVVHAVDQARVREPREPDYAEEAYSQQATLEYGYKEQAVGRRVVELSPE
RHVVTKAVKTEEVHVPPETRVAAAKKTEMAVSTQIKRTAETAVEKTVHVEHPRPRTASPH
FTVSKIAVPKPDHTYEVSIAGSAIATLEKELSATSVPKITRPVRPPLAKSPEPRAMPEKV
VSPPFPFVETAADTYERRYGTEMKREIGVSVAAGLVREHEHIELMQEGEPEVIEAARVPE
PAEVPATPPSIVSVLKDVTVMEGESVTLQCRISAYPAPTIAWYREDYRIESSMDFQITFE
AGVARLVIREAFAEDSGRFTCTATNEAGSVSTSCHLLVQVSEEFESKEAVSTKMVTEQKR
YVESKDITMAEVTMAAEEVSGEAAAPFFIRKPIVQKLIEGGCVIFECQVGGNPKPHVYWK
KAGLPLTTGYRYKVLHRKETGECRLEISMTFADDAGEYTIVARNKHGEVSASASLLEEAD
YEVYLKSQEEELYRTQVTAYVQEPKVAAVAPPTLYADYEKEYEREQALIRKKMAKDTVLV
RTFAEEQEFHISSFEERLIKEIEYRIIKTTLEELLEEDGEEMVVDISESETVEAGFELRL
KNYRILEGSGVTFHCKMTGYPLPKIAWYKDGKRIKHGDHYHMEVLSDGRASLRLPVVFPE
DEGIYTVFASNVKGNAICSAKLYVEPVGPTGSPGYIPSPEMIRRYRSLSPRSPSRSPARS
SPSRSPARRLEETDEGQLERLYKPVFVLKPTSFKCAEGQTARFDLKVVGRPMPETYWFHN
GQQVLNDYTHKIVIKEDGTQSLIITPATPDDAGEWVVIAQNRAGKASITMTLTVEAKEHL
VRPVFVEKLKNVSVKEGSKLEMNVKARGNPNPDIVWLKNSDIIVPHKYPNIKIEGTKGEA
ALKIQSTVRHDAAWYTATAINKAGRDTTRCKVNVEVEFTEPEPERKLIIPKGTYRAKEIA
APELEPLHLRYGQEQWEEGDLYDKEKQQKPFFKKKLTSVRLKRFGPAHFECRLTPIGDPT
MVVEWLHDGKPLEAANRLRMINEFGYCSLDYDVSYPRDSGVITCRATNKYGTDHTSATLI
VKDEKSLVEESQLPEGRKGLQRIEELERLAHEGAVTGVIEDQKVKQKPEIVLFPEPARVL
EGEIARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRLRYDGIYYLDIVDCKSYDTGEVKVT
AENPEGTTEHTVKIEIQQREDFRSVLRRAPEPKHEAPTTEPGKLLFEVQKVDKPVDKTTK
EVVKLKRAEKVSHEKVSEESEELRSKFKRRTEEGYYEAITAVELKSRKKDESYEELLKKT
KEELLHWTKELTEEEKKALMEEGKITIPTIKPEKVQLSPSMEAPKILERIQSQTVGQGSD
AHFRVRVVGKPDPECQWFKNGVQIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAV
NIAGETSSHAFLLVQAKQHIVFTQELEDITAKEKDSMATFECETSEPFVKVKWYKNSVEI
SPGDKYRTHSDRKAHFLSILMIGRSDADDYSCALVDDESVKTTAKLTVEGAVVEFLKELE
DLEVPESFSGELECEVSPEDVEGKWYHNDVEITPNKKYTVTSRRGRQILTVKDVGKEDQG
EYSFVADGKKTSCKLKMKPRPVAVLQGLADQKVCEGDIVQLEVKLSQENVEGVWMKDGVE
IQPSDRVHIVIDKQSHMLLIEDVTKDDGGAYSFNIPSLLLSTTGRVTVYSVDIIVPLKDV
HAIEGTKAILESKISVPDVSSSKWYINDQQIKPDDRVQAVSKGTKQRLVFNRTYASDEGH
CKLVVGKVETSCNLTIEQIQIIKGLHDITCTETQNVTFEVELSHAGIDVTWHFKDQELKA
GPKCKIEAHGTIYKLTVVSMMKDDEGEYTFYAGEKKTSGKLVVAGGAISKPLTDLTVAES
QRAVFECEVANPDSQGQWFKDGKPLTMTERCKSESDGLKRRLHIAISKLDDVGEYTFQVA
SSKTSAKLKVETVKIKKTLKNLTVTETQDAVFSVELTHPNVKGAQWIKNGVELHSSDKYE
IKMDGTIHTLKVKNCAVTDESVYSFKLGRIGANARLHVETVKIIKKPKDVTALENAVASF
EVSVSHDTVPVRWFHKNVELKPSDKYRMISQRKVHKLTLQNISPADAGEYTAVVGQLECK
AKLFVETVHITKTMKNIEVAETKTASFECEVSHFNVPAVWLKNGVEIEMSEKFKIVVQGK
LHQLNIVNTSSEDSAEYTFICGNDKVSATLTVKPVLITSMLKDINAEEKDTITFEVTVNY
EGISYKWLKNGMEIKSTDRCQIRTKKLTHSLSIRNVHFGDAAEYSFVAGKAVSAATLYVE
ARHIEFRKHIKDIKVVEKKRAVFECEISEPDVSVQWMKDGQELQLGDRMKVQRERFVHRL
LITSTRMSDSGKYTVVAGGNTSSANLVVEGRDVRIRSLQKDVQVIERQRAVVEFEVNEDD
IEAHWYKDGIEINFQIEERYHYVVERRVHRMTITETRYTDAGEYTFLAGRNRSSITLHVN
APEPPEIVKELQPATAESGKPARFCAIVSGRPQPKISWYKDEQPLSPGFKVKFLHDAQEY
TLLLIETFPEDAAIYTIEAKNDYGIATSSASLLVEVPEVVSPDVEVPVYPPTIITPLRDA
ITSEGQSTFFQCRVTGTDLRITWYCKDKEIKPSRFFRMTQYEDTYQLEIAEAYPEDEGIY
TFVASNSVGQVSSTATLKLEALERVLQEKIEQQIEMEVKEISSSVFVPAEEERPESYSNG
LQLPHRDKTVELMPENSVYSSSLEVKREKDHVPTFLKHVSNVEISLGEVARLSVTVTGTP
KPEIQWFFHSVQLTSCADYELVSDDEHYSLIVLSATFDHEGEYTCTASNIHGQTTCSAYL
KVNPKGESKDLEAEEATEIPQLPYFVRKLNSAQCVQGASAVFEYQMRGEPAPELQWFKGS
DPIFPSDHYTIIHNNSNGSGSLTVNNCQKKDAGLYFCRGFNPFGEATSSAELLILLDIVG
EFPDREQEAMHKRRSKSYKETASEQATESRLYAVKLPGEDQPQGMYTIGIEDRHALHSEE
VDALHMSSYSTATAQQEALHTQQTALLQSQDVEEIVDASSQAIQKTVPTSFTVSEVKEHP
GFLEQHSEPIQSPLVADLTSSQSHQVPDICLPVVEEIHQEDKEKGLQIKQPEIIKPQSAK
EDKLQFASVLSEEKYLLSSGESALLSAQGAGEVSSTSEPKHPASIPTIEGIQALSKETSL
AVQVQKMDNGILVQEEGRLFQSVVATVQHKISEAHTEALDYVDPPEEVNSTQEASNVLYV
PMTSSKQVLPKESILDEAVAAQAEGSLKQNRLVKTASVAEEKQQISSECTEEIPRLDSTV
IAEISREATKPWCLPVVHGQSTFPREEHFSPELLPDDEATSRKSPCLLYCLTTEEQASTS
CEEAKQFPPLDAAVSVPSAQEPVSVLHLQMNQAEQILPKEGIWAAQKPECQMALQKAEIL
VKRAVTSEEKNQIGAEVLETFQSDIAGEKTLVVAESQLRKCLAAVAEEMLLLKEQVLPEG
GKEQKITLKKEDFLMVMQVSMMAENKALDVGHTEPLKDIQARSCKAVSEPSVPSESTSIE
ERGIPMENTVFLEAAEQDFAARIQEGQSVRLPLILEEKQAFAEEHLDQLPRPEAENAEAK
KHPAVMKEMFETQEYNVFSKETLLAAEVPICCSFDKEAQKGSPLKVALVSQQHLFSPDAL
NNIKSVELKNAEVTREPKYTVCSGLTMTGSSNSAEITLALDGVYSHSANVKSELQAAFHS
VAYEEKHILMAEEQKGMFCIDSPVPQCAQMKTESKTHLEQLVSAQEVQTFNLKEEIKDVG
TTMLTLDVPSAAAPRETPTDVLKMSVRKEELFEENEEESIDKAREQEGRPLGEICPIVHQ
HVVDTVVEEGESVSLTSIIANAKTVNWYFEGKLVSSGDEFKCLQDHGTYTVVINQAFKEV
HQGEYACEALNEGGKTTTAAKLTVLKRVAPILRRRLESQEVAVNHLAKFTCETEMAPNVR
FQWYRAGREIFDGDKYTIYTANYTSTLQIPRPQVIDCGEYSCKASNQYGSVSSTAVLTVT
EAFPPTFLTRPESITAFVGKSVRFLCTVSGTPVIDTVWQKDGAAVSSTERCKITSSDNKH
SLEIAHLAVNDRGIYSCKASNRFGADICQAELAIIDKPHFIKELQPVQSAVNKKIHLECQ
VDEDRKVTVAWSKDGKRIPPGKDYKIYFEDKIASLDIPLAKLKDSGTYVCTAANEAGSSS
TSAAVTVREPPSFLKKVDPSYLLTPGESAHLQCKIKGSPEIQMTWFKNNKEIRESDTHRM
SFANNVAVLDIFHVKVDDSGSYSCEAVNDAGSDSCSTEIVVKEPPTFVKTLEPAEIVRGT
NATLQCEVSGTGPFEISWFKDKKQIRSSKKYRLTSQKSLISLEISSFNSADVGEYECSIA
NEVGKCICSATYILKEPPSFIKKFEGVTTLAGDTVTLQAAVKGSPPISVTWMKEKEIIKE
DNKVKVTFENGIATLQISDVQISSGGKYTCLAENDAGSQTCFGELAVKEPATIVERAEFL
EVTAGDPATLEYTIAGTPELKTKWLKDGKPLVSNKKCRISLKNNVAQLKFYAAELQDSGE
ITFEVSNDVGRSSCTTTFTVLDRTLPPFFTKPLRNVESAVGGSCHLNCKVSGSQPIKVAW
FKHDREITASAKYTLRYEEGSASLEIKHLDTSDVGVYSCRATNSAGTKETRSTLAVKEPP
SFVTEPESQDVVPGSTVRLKSTFKGTAPFSVEWFKGDSKLTTGGACYIMTEALSSYLELY
AVKPEDSGTYSCKVSNVAGSVACSAKLFVKEPATFVERLEPSQLIKKGEYAQLECKVKGT
PEIKISWFKDDREIKESDKYQMSLVGSKAVLSLLDITVEDSGEYICVAKNEAGKDTCSSV
VAVKESPYFIKEFEPREVLRDSDVILECEVLGSPPFEVYWLKDNKPVRSSKKHRITMERS
LISLQVFKFDSSDAGEYQCRVTNDVGSCVCSSEVALKGPPQFVKRIENISSLRGGTIVFQ
ATVRGSMPITISWLKDNDDIVEDDNTKMTFVNNVATLMIRAIEVKHDGKYFCQAKNDAGI
QRCSALLTVKEPATITDKAVSIDVTEGDPATLQCRFSGTKDITAKWFRDGKELTLGPKYK
ISVTDTVSVLKVVSAEKRDSGEYTFEVSNDVGSSSCKASINVLDLIIPPKFTKKLKKMDS
IKGSFVHLECIVSGSHPISIQWYKDGQEITASEKYKYSFHDNTAFLEINQLEGADSGSYT
CEATNKAGKNQCSAHLTVKEPPSFVEKPQSQDVIPSARVQFKAHVSGTPPIQIKWFKDSK
ELLSGASRSVYKDDTSTVLELFSAKTSDSGNYICQLSNDVGSTTCKATLFVKEPPRFIQK
PSPVVVLRKGQATSFECQVVGTPEIRVIWYLDGNEVLDLDKYGVSFLDNVATFKVSNARI
EDSGTYICEAHNDAGSESCSIELKVKEPPTFIRELKPVEVVKTYDAVLECEVAGTPPFEV
TWLKNNSEIRSGKKYTMTGKETLFSLQIMNCDFQDAGEYQCIIANEGGSCSCSTKVSLKE
PPSFLKKIENIHAVLKGSATFQATVSGSQPLTVSWIKDERILENDDNFHITFENHVAKLK
IKHVDLSHSGRYTCQAKNESGVEKCFALLLVQEPAQIVEKAKSVKVTERDPVTLECTVAG
TPELQVKWFKDGKQLMPSRYYTMSFDNNVARFRIESIMKEDSGAYTFKVENEFGSSTCEA
VLTVLDQSIPPSFIKKLPKMDKILGSSVHMECKVAGSLPITAKWYKDGKELPDSAKYRSL
CHENTVSLEISHVELTDSANYTCSVTNVAGSDSCSTILTVKEPPSFLVKPESQHAVPDST
VEFKAVLKGTPPFKIKWFKEDLELVPGPNCLFGIEGSTGFLNLYSVDVSRSGNYTCQVSN
DVGSDSCSTTLSITEPPKFVKKLEASKVVKQGDSSRLECKITGSPEINVVWYRNDMELHP
GEKFQMSFSDSVAVIEMRHLGAEDSGDYICEAQNPAGKTSCSTKLLVKEPPAFSRKPSPV
DTLKGTEVSLECEISGTPPFEVTWYKDKRQIRSSKKYKVTSKNYHASVHILNIEAADIGE
YLCKAQNDVGSDTCICTVKLKEPPKFVTKINNLTVVVGEPVELQATVEGSQPISVVWLKD
KEVIRESENRTITFVENTATLQLAKALPASAGKYICQISNDAGTRECIGTLTVLEPAIIV
EKAEPMKVTVGDTCTLECKVGGTPELSVGWFKDGKELTSSEKYKITFYNNVSTLKILDSE
SEDSGLYTFEVQNNVGKSGCTASVDVLDRIIPPSFTRKLKETHGVLHSSMALECKVAGSP
PMTVAWFHNGHKITSGEKHQIAFSDNICGLQINSLSPSDTGTYTCKAANVAGSAETKAVL
TVQEPPSFVKEPEPVEILPGRSVTFSAVVRGTPPLKMKWFRGVNELVTGDKCNIRLEDTV
TKLELFAVEPSQSGEYSCVVTNDAGKVSCTTRLSVKEPAVFVKKLSDHCVEPGKSIILES
RYTGSLPISVMWKKNGAILSQSEKCSITTTEKSCILEILNSTKDDQGEYTCMVENEAGGD
VCEALVTTLEPPSFVTHLGPLEVSVGDYTTLQCQVSGTPEITISWYKGDTKLRSTPEYKM
YFKDNVATLIFNKVDVSDSGEYICKAENSVGTASSKATLSVQERKRPPSFARKLKDTEQT
LGFPVKLVCRLNGSEPISVTWYKDGVPLRDDFNVQTSYIDNVATLHLLQTEMGHTGQYSC
TATNPVGTATSSARLQVTEPRQAPLFDITPESKDVPVGESVDLECHVTGAQPIHVAWAKD
GREIRTGGNYAITFAANTAHLRILRVGKGDSGQYTCQATNDVGKDFCSAQLNVKEPPKFV
KKLEATKMVKQGDSCQLECKISGSPEIKIVWYKNDHEIHASDKHHMAFSDSTAALVIVDA
NPEDSGDYICEAVNSAGTASCSTTVIVKEPPVFSKKPSPVDTLKGSDVILQCEIVGTPPF
EVAWFKDRKQVRSSKKFKITTKNFSASVHILNLEAADTGEYQCKVANEVGSDTCSCAVKF
KEPPRFVKKLSDTSTYSGEPTALRAVVEGSQPISVLWLKDKGEIIRESENVQISFSDNIA
TLQIASAEATNSGKYICQIKNDAGMRECAGYLQVLEPAVILEKPEPMTVTAGNAFTLECT
VGGTPELVAKWFKDGRELASSRKHQITFFNKVATLRVLSANMDDRGLYSFEVQNEVGKSS
CTLSVNVSDQIVPPSFVRRLKETFGVLGSSVVLECKLAGSPPMSVTWFYGGNEIFSGDKY
ETAFSDDVCALKVNALDSSDTGPYTCAATNAAGSDECSAFLTVQEPPSFAKTPDPLEVLP
GMSVTFRSIMRGTPPFKVSWFKGSRELVPGKTCNIKLADTTAELELFDVGPLQTGDYTCL
AANNAGSASCTTHLFVKEPAVFVKKLSDFSVEQGKSIILESTFSGTPPLAVTWKKNGMNL
TQSPKCNITTTEKSGILEILSSNRGDEGEYTCEVANDAGEDTCHAMVSILEPPYFVKHLE
RVEVTVGEPASLHCQVAGTPEIKVSWYKGDTKLRSTQAYKMHFKNNMASLTFSQVDNTDI
GEYICKAENSVGFATSTAVLTAKEHKLPPTFTRKLKDVQETVGSPVAFDCRIVGSEPIEV
SWYKDKVLLHDDDNIQTAFLNNVATLQILQTDMAHCGQYTCSAHNALGTASSSAKLHLTE
HLKPPFFDVKPSPLDVALGESAAFKCHVTGSMPMKIIWTKDNREIRPGGNYKITLVENTA
TLTFLKVGKGDAGLYTCYASNSAGKDSCAAQLSFKEPPRFIKKLEPSRVVKEHDSARYEC
KIGGSPEINIVWYKGETQIHPSSKYSMSFVDSVAVIEMHNLSVEDSGDYTCEAQNAAGSA
SSSTSLKVKVPPVFHKKPRPVEILRGSDVHLECELRGTAPFQVSWYKDKREIRSSKKYKI
LAENYLASLHILNVDAADIGEYHCKAVNDVGSDTCLGSVTLKVPPKFVKKLHDVTAVVGE
PAELQATVEGSEPISVVWLKDKGEIIRESDNVWMSYSDKVAILQVVNTEPTNTGKYTCQI
KNDAGSQECFATLSVLEPASIVEKPGPMTVTAGDSCTLECTVAGTPELSARWFKDGHELS
SDHKYKITFFNKVAGLKILNTGLEDSGEYTFEVKNNVGQSSCAASVHVSDRIIPPSFTKK
LKETHGLLGSSAVLECKVIGSPPISVSWFRDGYEITSGDKYQATLTENTCSLTVNTLEES
DIGNYTCIATNVAGSDECDAYFIVREPPSFVKKPESLQVLSGANITFTSLLKGTRPLEVK
WFRGSEELVPGHRCNISLEEFVAELELFDVHPVQSGDYTCIVTNEAGKISCTAHLFVKEP
AKFVKKLNDLSIDRGKQIILECTFTGTPPIAVSWKKNGVKIAQSEKFHITTTETSAILEI
SSSKLDDGGLYSCHIENDSGQDNSQATVSILEPPYFVKNLEPVQVTIGDSASLQCQIAGT
PEIIVSWYKGDTKLRATDTTKMHFKNHVATLVFNQVDSHDSGEYICKAENRVGEAASSAL
LSVQERKLPPSFSRQLRDIHETVGLPVTFDCGITGSEPIEVTWFKDGAQIRDGYNVQTSY
LNNVATLQISQTDMSLAGQYTCTASNAIGTASSRARLILTEGKAPPFFDIPIASVDAVAG
DSADFECHISGTRPIKVTWSKDNRELRTGGNYQISYVENIAHLTILKVGKGDSGKYSCHA
SNEVGKESCTAQLNIKERQIPPTFTKKLSETVEETEGNTFKLEGRVSGSQPMTVSWFKNN
REIYASQNCELSFQNNVTLLHIKHAGQADAGLYTCKVSNEAGSVLCTSSVVIKEPKKPPV
FDQPLKPVTIDEGKILQLSCHVQGSQPIRIQWLKAGREVRSSDKCSLSFANGTALLEVQA
VSKMDSGEYVCKASNVAGTDSCKSKVTIKEKPAAAPAAKKAPTDGKLYFVSEPQSITVIE
KSVATFIAKVGGDPIPNVKWMKGKWRQLNQGGRIIIQQKGDEAKLEIKDATKTDSGQYRC
VAFNKHGEIESSANLQVEERKQEVVEGDLRAKLKKTPTKKKEDEEEKAIDIMELLKNVDP
KEYEKYARMYGITDFRGLLQAFELLKQSQEEETHRLEIEVRERSRKEEQEFDELVSFIQQ
RLTQTEPITLIRDIEDKTVLTDEDAVFECEIKINYPEIKLSWYRGTEKLDSNNKYEIRIE
GDRHILRIRNCQLGDQGNYRVVCGPHIASAKLTVIEPAIERPLRDTALKEGFTCSLVCQF
SVPNAKSQWFRDGKPLKIGGRYSTEVSEKVHRLIIKDVRTEDQGHYTCRFERNLETSASL
TIEAEPIQFTKTIQNIVVSEYQSATFECEVSFDNAVVTWYKEKTELRESHKYSFRSEARC
HYMTIHNVTADDEGVYSVIARLEPRGEARSTAELYLTTKEIKLEIRPPDVPDAKVAVPVE
APTEEVPALPIFIPLPEEKKKEKVVKKTIVKKVTKKEVPKPPEEVAPPKVPVKKPQEVKV
VAVPKKKEEAYEKKEEIYEVHREAYEEWEEDYGEKYEYYEREEGYDEEEEEWQYGEREVT
YEEKQYHEEVVHVPRKPEPVHKPPEISTKREEKKKVVVQKVTRKPVVEEVERAAQRMEEE
KVKRIRAPEVPPEKPARKVVHEEVIERKVPAEEKWTISEEKISVSYHREEEYTYSEPEEY
EEDSVYVEYPTEEPEEYEEERYYVEAPEVPPPKVPEVHVKVKEPVPVPKKVEPPPPKIPE
VPKKVVPERKKPTPPPKPEAPPAKVPEVPKKPVPEERKPTAVPKKEVPPPPKVPEVPKKV
PEVPKKVPEEKVLVPKKKEAPPAKVPAVQKKVTPEEKLPVAVPKKVEAPPAKVPEVPKRA
VVEEKVFAAEEKISFAISKRVEAPSPEVEKWAEEVAEEEVEEEEETVSYEREEEISYERE
EEISYEREEISYEREEISEEAYYAEEVVHVTVPEEAPPAKVPMIRKRPEPEKKAPMAVPK
KVEAPPPTIVSKKIPPEEREPPKVKEPPPPKVIEVHKKKVVTEEKIAVTKKEEAPPKRVP
AVAKKPVPEEKVPVPVPKKKVAPPAKVPEVPKTMISEEKVSIAVPKPKPPPPTKAVEERW
GYAEEVSVTLHTEEEVSYTVPEEPERITKKERLPITIATKVKKPPTKAPEVRKAVVEKEV
VHVEVSPYVEEEEEEEEEATPYEEVPPQYEEEEVAEYEEEISRYEEEVTRYEEKVSQYEE
EITHYEEEEEVPPYEEVPEYEEEEEVPPPPPPPAKVPEVPKKPVPEKKVPAVPVPKKKEA
PPAKVPEVPKKPVPEEKVPVPKRKEAPPAKVPEVPKKVVPEEKVPVPIPKKVEAPPAKVP
AVPKKPVPEEKVPAAVPEKIKPPPPKVPEVPKKIVTEAKVPLAVPKKPEPPPAKVPEVRK
EPLPEEKVPIFVPEEEEPVPAKVPAVPKKVVPVKKVPEAVPKKVEPPPPPPPKVPEAPKP
VPEEKVPVPKKVPAPPAKVPEVPKKVVPEKKVPAPPPKKVEAPPAKVPMVPKKPTPEERI
IVPPPSVEKYVYEEYEKYEAYEKIEEFLQVEEGEEPEEYEEAPEPEEYEEAPEPEVYEEA
PEEPQVEEYEEAPEPEELEYYEEVQETKEIEEYEEVYEVPAAIVPAVPKKPVLEEKVPIA
VPKKEAPPTPKVPEVPKKAVPEEKMPKAVPKRKEPSPAKVIAVPKRGVPEEKIPIIEEKI
PITAGEPEELPTVEAPAVHEKILWEEQVTYIIPREKEAISVEVLEWKEEVLVEEKAPAGI
PKKPKAPPAKVPPTVKKIVPEKKKPTAEPKEEAPLITGTEVRKKVISEEELPAPVSRKEV
IHHEVAETYEEILLEEKEQRVPAAISRKRDVPPTKVSEVARKGVAEEKTSVAKLEKPEPV
SIHKKAEPTVAPKIAQPQVLEEKRVVTKPSKPEPVVVPKPAEAKKKIVASKPTKPEPGVV
VETTEPQVAEKKVAVAKTRKMEPAVVSKTKESVTLEDQVAEKLEHTVVLERVQAEEKRTV
RTKPKKAETVRMPQEGEPQVPKEKIRVAKPGKPESVVVPESIEHEEEVEEEVIAKPRKLE
PTVVPEVEEEEIDITEPYHAERIVVLETTEPQVAEKKVAIGKTRKMEPVMVSKTMESVTL
EDQVAEKLEHTVMLERVETQVSEKRTVMTRPKKTEAVIVPKEEAPQVQKQKIRVTKPRKP
ESVVVPESIEHEEEVEEEVIAKPRKLEPTVVPEVEEEEIDITEPYHAERIVVLETTEPQV
AEKKVAIGKTRKMEPVMVSKTMESVTLEDQVAEKLEYSVMLERVETQVSEKRTVMTRPKK
TEAVIVPKEEAPQVQKQKIRVTKPRKPESVVVTESIELEEEAAEEEVIAIPSKPEHIVVP
EATETQVAEKKIAIAKPPKMEPVRAETRVSEKKTVMTKPKKIEAVVVPKEEEPEVQKQKI
RVTKPRKPESVVVTESIELEEEAEEEEVVVIPSKPEPTVVPGVEEEEIAMTEPPKAERIV
VLETTEPQVAEKKATTAKHKKPAPVMVPTIVEPQVPKQKIAVGKPKKPEARPKPLELEME
EEHVTVVELREREHTVILETAEPYVAEEEPVLAKPKELERDTVPEPVELPALKVPEVPKK
VVPEKKVVPEAPPEKVPEVPKKLVPEEKIVPKKPEAPPAKVPEVPKKPVPEEKVPVAVPK
KPEPPPAKVPEVPEKVVPEKKVPAEVPKKPEAPPPKVPAVPKKVVPEEKVPAPELKKPEP
PPAKVPEVPKKIIPEEKVPAREPEPPAPKVPEVPKKVIPEKKPPEPEAPPAKVPEVPKKI
VPEEKIPKKPEPPPAKVPEVPKKVVPEEKVPTLKKKEPPTPKVAEVPKKPVVEEKEPIPV
LKKPVLKKPEPPPPPAKEPKLEAKEVVHYEEREVRTVTGVRELKQVSVYQDIEAITALEE
PEQVSAYEITPPEEYIAEAREAIVLYEEEETVAIPEEPEVVTAPEEPSPPTVPKPKPVPV
RKKAEPAAPPKKPEPAPVPKKSKLAPVPKKPEPPVVLKKPEPLFKKPERPPVEELDREEE
REVETFIGYRERKHVSVHQELQAISAFEEPEQVSTYEITELEEYMAEEREALISYEEPEP
VAVPEEPEVTAVPEEPAPPIVPKKPKPVAVPKKAEPAPVPKKPEPAVVPKKPQPAAPPKK
PEPAPVPEKPKLVPVLKKPEAKKPEPAFKKPEAPAVEALVHEEEREVQTFIGYRERKHIS
VHQDLEAIAALEPERASAFEEPEPEEYVAEVREALIAYEEPEPPSAPEEPKVAAPVEPKK
PERPPAKVPEVPKKDVPEKKVPAPVLKKIKPPPPKVPEEPKKIVPEKKIPAVALKKPEPP
PAKVPEAPKKAVPEEKVPAVVPKEPEPLPPTEPEVTEEIEPEELIPAPVPEKEEIIPTEE
EPEPEKKIPEKPKPRVPFPPKEEVKEEKVPFKVPGLKPRKQLPPPPPTPKEEVVLKKVPR
AVKKPEEEEAKPEKDLKVEPKPVIEKIKKPEVPEIPKKKTEILPLKKREEKEKPVPEPAK
VPEPKPATLPEPKPVTALKSPKPAAEPKPEAAPVTAPVVGKKAEPKATPEKEPAKGRSPI
KAKKTPSPADAERRKLRPGSGGDKPPEEPPFTYQLKAVPLKFVKEIKDVVMTEAESVGSS
AIFECLISPSTAITTWMKDGSNIRESPKYRFLSDGKDRKLHIIDVQLSDAGEYTCVLKLG
NKEKTSTAKLVVEELPVRFVKTLEEEITVVKGQPCYLSCELNKERDVVWRKDGKIIKDKP
GKYAIGIIGLQHAVTIMDADDTDGGEYSVTVDIANISCKTTVKVVEVIKDWLVKPIRDQH
VKPKGTATFTCDVVKDTPNIKWYKGDEEIPMEPNDKTEILKDGHHLYLKIKNATPDDEGE
YSVEVEGRRYPAKLTLGEREVELLKPLEDVTVYEKETATFDAEISEHDIPGEWKLKGEIL
RPSPTCEIKSDGGKRFLTLHKVKLDQAGEVLYQALNAVTSAILTVKEIELDFAVPLKDVT
VPEKRQARFECVLTREANVMWSKGTDIIKVGEKFDIIADGKKHILVINDSQFDDEGEYTA
EVEGKKTTARLFVEGVRLKFISPLKDQTVKEGETAHFEFELSHEGMPVTWYKNDKKLHTR
RTVHITAEGKKHKLEIQEVTLDDISEIKAVVKNLHTQAHLKVLEADPYFTVKLQDYTATE
KDDVVLECELSKDVPVKWYKDGEELTASKKISIKTDGKRRILKIKKVSDADKGNYECNCG
TDKTNSEFKVEARLIKIERPLYGVEVFVGETARFEVEVSEPDVHAIWKLKGETLTPSPEC
EIIEDGKKHILVLYNCKLDMTGEVSFQAANAKSAANLKVKELPLIFITPLSDVKVFEKDE
AKFECEVSREPKSFRWLKGTQELKGDERFEIIPEGTKHALVIKTVAFEDEAKYMFEAEDK
RTTAKLIIEGIRLKFITPLKDVTAKERETAEFTVELSHDNIPVIWYKNDQRLHTSKFVSM
KDDGKFHTLTFKDLNIDDTSQIRVEAMGKSCEAKLTVLEGDPYFTGKLQDYTAVEKDEVV
LQCEISKANAPVKWFKDGKELTPSKNVIIKADGKKRILILKKALKKDIGQYTCDCGTDQT
SAKLNIEERDILIVRPLYSVEIFETEMARFETEISEEDVHGNWKLKGEPLTQSPDCEIKE
EGKRHCAVLYNVRLDQAGPVDFQAANAKSSAHLRVKPRVIGLLRPLKDVTVTAGETATFE
CELSYEGIVVEWFLKGQKLEPSDKVVPRAEGRVHSLVLRDVKLTDAGEVTLTAKDFKTKA
NLFVKEPPVEFTKPLEDQTVEEEATAVLECEVSRENAPVKWFKNGQEIHKTKKYDIIADG
RVRKLIIHGCTLDDAKTYTCDAKDFKTSCFLNVEPPHVEFTKPLTDLEVREKEVARFECE
ISRPTVKSKWFRDGVEIRKGKKYDIITKGAQRILVINKCLLDDEAEYACEAKTARTSGML
TVIEEEAVFTKNLPNIEANETDTVKLICEVSKPGADVTWFKGDEELPDGGRYEQIAEGRK
RILVIHNARLDDAGAYSCKLPSTKTTGKLKVNELAAEFITRPQNIEVLEGERAEFVCSVS
KEAFEVQWLKADTVLEAGDKYDIISDGKKRILVVKESVLDDEGTYAVMVGDAKAKARLRV
IEKLRIVIPLKDQEAKEGQELVFNCEVNTEGAKAKWYKNEEPIFDSAKYIIVHKDLIYTL
RIRDAQMNDQATYTAALTNQRGEHVKTSAALTVLEEDLRIVEPLEDIETMEKKSVTFWCK
VNRLNVTLHWTKNGEEITFDRRVLYKVDKYKHSLIIKNCGFVDEGEYTVTAGQDKSVAEL
IITEAPTDFIEHLQDQTVTEFDDAVFTCQLSKEKASVKWYRNGREIKEGKKYQFEKDGNL
HRLIIKECRPEDECEYSCGVDDRRSRARLFVEEIPVEIIRPPQDIYEAPGSDVIFYAELN
KDKVEVKWLRNNMIIVQGDKHQMMSEGKVHRLQVCDIKPRDQGEYRFIAKDKEARAKLEL
AAAPRIKAADQNLVVDVGQPLTMIVPYDAYPRAEAEWFKEDEALPTLTVDTTAESSTFRI
YEAKPSHRGNYKVILKNKHGQAEARIHVQVIDVPGPVRNLEVTETFDGEVSLAWEEPESD
GGSKITGYVVERRDIKRKTWILATDRADSCEYTVTGLQRGGVEYLFRVSAKNRVGTGEPV
ETDKPVEAKSRFEVPGPPLNVQVVDVNRSGATLTWEPPEYDGGTPITGYVVELRDRASIK
WEPAMTTGPDDLSATLTDVVENKEYFFRIRAQNQVGVGKPSASTHAVKIMDPIKKPSPPI
NLDHSDQTKTSVKLTWEPPLKDGGSPVLGYIIERREEGTDNWVRCNPKLVPSLNYKVTGL
TPLAKYYYRVSAENAAGVSDPAEAIGPLTADDTHVGPTMDLSGFKDGLEVIVPEPLKIRV
PITGYPVPTATWSVGDKVLEQGGRVKIETSIAFAQLIITPSERPDKGIYTLKLENPVSSV
SGEIDVNVIARPSAPRELKVGDITRNSVQLTWEPPENDGGSPLTGYVVEKREVSRKTWIK
VIDNVLDQEFIVPDLAQGKEYLFRVCACNKCGAGEPAYIDEPVNMSAPATVPDPPENVKW
RDPTSKSIFLTWEPPKYDGGSRIKGYIVEKCQRGTDKWEPCGDPIIETKMEVTKLKEGEW
YAYRVKALNRMGASKPSKPTDDIQAVDAMEAPEIFLDVKLLAGITVKAGTKIELPARVTG
KPEPRITWTKADHVLRPDKRISIETKPNQSIVTITDSKRDDSGTYIIEAVNTSGRATAVV
EVNVLDKPGPPAAFDVSDITNVSCLLTWNPPRDDGGSRITNYVLEQRAADSEIWHKLSST
IKETNFKVTNLTPHKEYIFRVSAENMYGVGEPVQSEPMIAKYPFDTPGPPTQVQPVEITK
DSVTLTWAEPDDDGGSPITGYWVERLDPSQDKWVRCHKIPVKDTTFKVKGLMNHKKYKFR
VLAENLAGPGKPSKATEPILVKDPIDPPWPPGKPTVKDVGKTSCFLQWTKPEHDGGAKIE
SYVIELLKTGTDEWVRVADGIPTPEHFLKGLMEKQEYSFRVRAVNKAGESEPSEPSDPVL
CKERLNPPSPPRWLEVINITKNTADLKWTVPERDGGSPITNYIVEKRDVRRKGWQTVDTT
VKDTKYTVTPLTEGSLYVFRVAAENAVGQSDYCEIEDSVLAKDTFTTPGAPYALTPVEVT
KRHVDLKWQPPKNDGGRPILRYVIEKKEKLGTRWVKAGKTAGPDCNFRVTDVIEGTEVQF
QVRAENEAGCGHPSEPTDILPIEDPTSPPSPPLDLHVTDASRKHISIAWKPPEKNGGSPI
IGYNIELCEAGTEKWMRINSRPIKDLKYKAEEGIVPDKEYVLRVRAVNAIGASEPSDISE
NVVAKDPDCNPTVDIKTKDLVVVEGEKLSIPVPFRAVPSPTIAWHKNGKELKAGERTTIK
SDYSSALVEVTNVVHADAGVYTITLENRLGSTTGTVNVKVIGLPGQCQSIKASEVTKNSC
KVTWEPPEFDGNTPILHYVLERREAGRRTYIPVMSGENKLAWQVKDLIPNGEYYFRVKAV
NKIGGGEYLELRNPVIAEDPKQRPDPPVDLEVHNPTAKSVTLTWKPPLYDGGTKILGYVL
EKLPKGGEKWERCNDFLVPLLTYTIKDLEEGQQYQFRVRAENAAGVSEPSNITPMTKAMD
PIEAPKVFLAASLRDGLEVRQGSEIQLEAHISGSPYPAIAWIWNDDVIKPTEIKKRVTKI
TRRKKGEVEEDEPFYLSLPERLNIDNSKRGTSLLAVRDSIRKDHGTYTIRVENDHGVAKA
TCEVNVLDLPGPPVNFVFEDVRKNSITCKWEPPLDDGGSDILNYTLEKKDNTKAEIGWVT
VTSTLRHLKYNVVKLIEGKEYIFRVKAENRVGAGPPCVSKPVVAKDPFGPPDAPDKPLVE
EPSSSSMLVKWNEPKDNGSPILGYWVEKREINGTHWARVNRELVNALEMRVEGLLEGLTY
VFRVCAENAAGPGKFSPPSDPKIAQDPIMPPGPPVPRIVDTSSTAIDLEWDAPLYNGGGD
ITGYFIYKQFMGSNEWSRCNDKAIKVRSYIVKGIREGADYKIRVTAVNIAGEGPPGETEP
ITVAEPQEPPTVELDVSVRAGVQILAGQTLRLPAVVTGRPIPTVVWTLEDGEIDKERVEI
ENVGTSSVLTIKNALRKDHGRYMITATNDSGSKFAATRVEIFDVPGPVTDLHPVVVNRKM
CLLNWDDPKDDGGSDLTGFIVERKDAKMHTWRLAVDTERSKCDITGLVEGQEYKFRVSAK
NKFGCGPPVELGPILAVDPKGPPTAPERFMYTERTKSSVTLDWKPPRNDGGSPIIGYIVD
KRRHDSNEYERVNKRLCPTTSLVVDNLAELHMYEFRVKAVNEIGESEPSLPLNVVVQDDE
EPPTVTLHLTVRGDTIKVMAGQPVNMPADVTGLPMPKIEWSKDEVVIDKSTDARKITKKE
VSRTEAKTELSMPAVTRADKGTYTVTASNRLGTAYRNVHVEVFDRPSPPRNLTVSDIKAE
SCCLTWDAPLDNGGSEITHYIIDKRDASKKKSEWEEVSSTVVDRRYGVYKLTTDGQYQFR
IRAVNRFGTSDECLSEKVVIKDPYGLPGPPGKPKVIDHTRSSMLVTWKPPLDNGGAPITG
YWLEKKEEGGVYWSRVNRAPVTKPAVKGLEFNVLRLIEGVKYQFRAMAINIAGIGPPSEP
SDLYEAADPVFPPGAPSCPDVKDRTKSTISLAWKPPQKDGGSPIKGYIVEMQEEGSSDWK
NVNEPDKLFPTCECVVPNLKELRKYRFRVKAVNAAGESEPSLATSEIECKDILEEPEVYI
DVGAQDFLSCRTGTTIKIPAVIKGRPIPKTSWEFEGEAKKVLKDVHTIPEDATVDSTDTT
SVITIPECNRGHSGKYSITAKNKAGQKTVNVRVNVLDVPGPPKDLKVSDITRCSCKLSWK
MPDNDGGDRIRNYIIEKRTVEGKAWTKVNPNCAGTSLIIPDLIAGQQYFFRVRAENRFGI
GPPADTIQRTTARDPIHPPDPPIKLKIGLITKNTVNLSWKPPKNDGGAPVTHYNIECLRW
DRTGEGKEAWRQCNRRDVEETMFTVEDLKEGDEYEFRVKAVNEAGPSRPSATVGPVVVKD
QTCPPAITLREFMEVEEGTDINIVAKIKGVPFPTLTWVRAPVKKPDDKLPVIYDQHVNKI
VGEDSCTLLIQQSRRKDTGLYTITAVNKFGTDSKEMRLNVLGRPGPPEGPIKFEAISADH
MTISWLPPKDDGGSKITNYVIEKREANRRTWVPVTNEPKECIYTIPKLLEGHEYVFRIMA
QNKYGIGEPLDSEPETARNLFTVPGICDKPTVSSITHDSMTVNWEEPEYDGGSPVTGYWL
ERKETTGKRWTRVNRDPIKPMTLGVSYKVTGLIEGSDYQFRVYAINAAGVGPPSLPSDPA
TARDPIAPPGPPIPKVTDWTKSSVDLEWAPPLKDGGSRITGYLVEYKEEGKEEWEKAKDK
EIRGTKFVVAGLKEGGFYRFRVRAINAAGIGEPGDVTEVIEIKDRIVAPDLSLDAHVKDR
IVVHAGGVIRIIAYVSGKPPPTITWTKDERALPGEANIEETAISSSMVIKNCKRSHQGIY
TLLAKNAGGERKKAVIVDVLDVPGPVGIPFLTENLTSDSCKLTWFSPEDDGGSAITNYII
EKREADHRAWTPVSYTVTRQNATVQGLIEGKAYFFRIAAENIIGMGPFVETTKELLIRDP
ITVPERPEDLEVKAVTKDSVSLTWNPPKYNGGSDITMYVLESRLIGKEKFSRVTKEKMLD
RKYTVEGLKEGDTYEYRVSACNIVGQGKPSFCTKPITCKDEIAPPQLELDIRDKLTVRVG
EAFSLTGRYSGKPAPKVTWYKDDITVKEDKRTKIQTTPATLCLGILKSTREDSGKYSVVV
ENSSGSRKGFCQVTVVDRPTPPVGPVIFDEVHKDHFVITWKPPLDDGGSPITNYIIEKRD
ANRDIWMPVTSACVKTTCKVPKLLEGRDYVVRIYAENLYGMSDPLESDEMKAKDRFSVPD
APDQPIIKNVTKNSALVTWNRPRDGGKPITNYILERKETMSNRWTRVTRDPIYPDTQFRV
TDLLEGCEYEFRVSAENEIGVGEPSPPSKPFFAKDPIVKPSPPINPEAVDKTKNSVVLSW
QPPRHDGGGKIIGYLIEYQKVGDEEWKKANHTADACPETKYEVIGLTEGAKYKFRVMAVN
AAGESEPAYVRDPVEVKDRLEAPELILDANMAREQHVKAGDTLRLSAVIKGIPFPKVSWK
KEDKEVSTKADIEVTKVGSKLEIRNAAHEDGGIYSLTVENPAGSKTVSVKVLVLDKPGPP
RDLHVSEVRKDSCYLTWKEPEDNGGSVITNYIVERKDVAAPQWLPISSSSKKHSLLAKYL
MEGTQYLFRVAAENQYGRGPFVETLKPIKAVDPLHPPGPPKNLHHIDVDKTEVSLVWNWP
DRDGGAEITGFLVEYQEEGAKDWTKFKTVPVPECVVTGLQQGKIYKFRVKAQNIVGLSLP
DTTIPIECQEKLVPPSVDLDVKLIEGLVVKAGTTVRFPAIMRGVPIPTAKWVTDNTEIKS
EGNYKIDTDNYSTVLTIKSCTRKDTGEYLLTVSNAAGSKTVPVHLTVLDVPGPPTGPIDI
LEVTPDHMVISWRPPKDDGGSPVINYIIEKRESNRETWGVVSSGINQTRIKIPRLHKGHE
YIFRVCAENKIGIGAPLDSQPAVAKAMFDPPSPPGKPVVHDILENAATVTWSIPKSDGGT
PIIGYILERREISGKWVRVNKSPVLDLRFRTTGLFEGNTYEFRVFAENSVGISQPSPVSD
PIKAARPIKPPGPPINPKLKDKTRETAELVWTKPLKDGGSPILGYVVECQKSGTTQWNRI
NKDELIRQCAFTVPGLIEGNEYRFRIKAANIVGEGEPRELPETVLAKDILSPPELELDLT
CRDVITVRVGQTIKITGKVKGRPYPDITWSKDGKTLTKDQRVEIIQEYPHIELQVKKAVR
ADHGKYLISAKNSSGHAQASAVVNVLDRPGPCRNLKVSYVTKDSCMVSWDNPEDNGGSEI
TNYIVECRHPNQRGWSIVSADLTKRLVKAHLIENQEYFFRVCAENKVGPGPIVETKTPIL
AINPIDRPGEPENLHIAETGKTFVYLKWRRPDYDGGSPNLTYHVERKLKDSDEWERVHKG
SIKETHYMVDKCVENKIYQFRVQTKNEGGESDWVKTSEVVVKEEVQKPVLDLKLSGVLTV
KAGEPIRIEAGLRGKPQPEVSWAKDNADLSKSPRVKIETTSNFSKILLTKARRTDGGKYV
ITATNPAGSFVAYATVNVLDKPGPVRNLKVYDISIDRCTVSWDPPEDDGGCEIQNYIVEK
CESKRMVWTTYSSSVIMNSVHVTRLIEGNEYIFRIRAENKMGTGPPTETKPIIAKTKYNR
PGPPDPPEVTRVSKEEMTVVWNPPEYDGGKSITGYILERKEKRSLKWVPVTKTAIPERRK
KVQNLIPGHEYQFRVRAENEIGIGEPSLPSRPAIAKDPIEPPGPPTNLKVVDSTKTSITL
GWGKPVYDGGAPIIGYVVEMRPKTEKAGPDEGWKRCNVAAQVIHTEFTVTSLDEKELYEF
RVSAQNQVGIGRPADLKEAVSPKEILEPPEIELDASLRKLVTVRAGCPIRLFAIVRGRPA
PKVTWRKVGIDNVIRKGQVDLVDTMAFCVIPDSTRDDSGKYSLTLVNPAGEKAVFVNVRV
LDTPGPVAEFKVSEVTKMTCQLSWTPPENDGGSPVTHYILEKREADRKTWAKLVGDIKKT
SFKVINLVPGTEYFFRVTAVNEYGPGVPRDTPKPILATDPLSEPDPPRKVEVTEITKNSA
TLGWLPPLRDGGSKIDGYIISYQEEGQAADRWTQYSIVRDLHIVVAGLKEGKTYKFRVAA
RNAVGVSLPRETEGKYEIKEQLMPPKILMPEQVSIKAGLKLRVEAHIYGKPNPTCKWMKG
DHDVHISSRLAVHKGDSMSVLIIKDVTRKDSDYYTLQAENSAGVATQKIKVVVMDIPGPP
QPPFEISDIDADACSLSWHIPLEDGGSNITNYVVEKCDVSRGDWITVVASVSKTNCRIGK
LTPGQEYMFRVRAENRFGISEPLQSDKMIAKFPFDVPSEPKNARVTKVNKDCIFVAWDRP
DSDGGSPITGYLIERKERNSLLWVKANDTLVRSTEYPCAGLIEGLEYTFRIYALNKAGAS
KPSKPTDFVTARIPVDPPGKPEVIDVTKSTVSLIWTRPKHDGGSKLIGYFVEACKLPGDK
WVRCNTTPHQIPQEEYTATGLEEGAQYQFRAIAKTAVNISWPSEPSDPITVQAENVPPKI
ELGVGMKSLIVVKAGSNVCLEANVFGKPMPTITWTKEKEVLKPAEGIKITTKRNLSTVEL
FSVNRKQTGDYTITAENASGSKSATVKLKVLDKPGPPASVKIANMYTDRAMLSWEPPLED
GGSDITNYIVDKRETSRPNWAQVTANVPITSCSVEKLIEGHEYQFRICAENKYGVGDPIL
TEPAVAKNPYDVPGPCDPPVISNITKDFMTVSWKAPADDGGSPITGYIVEKRETKAVGWT
KVNRKPVIERTIKATGLQEGAEYEFRVTALNKAGPGKPSAPSKGAYARDPQYPPGPPAFP
KVVDTTRSSISLSWSKPAYDGGSPIIGYLVEVKRADTDNWVRCNLPKNLPDTHYVVTGLT
ENTEYQFRIYAVNKVGYSDPSDVPDKHLAKDILIPPEGELDAELRKVLILRAGVTMRIYV
PVRGRPPPKISWSKVDANIRDRQGLDIKSTDFDTFLRCENVNKYDAGKYVLHLENSCGKK
SYTIVVKVLDTPGPPINLIVKEASKDSAFISWEPPIIDGGSPVKNYVVEKRDAERKSWAT
VATECPKTSFRISNLEEGKSYFFRVFAENEYGIGDPCETRDAVKASETPGPVIDLKAPHV
TKSSCSLSWKKPISDGGSRINAYLVELMVGENQWQEVMRSKNLQYSSRDLKEGNEYTFRV
RAQNEAGYGTPSEITVVARDDIVAPDLDLRDLPGLVYLAREGSSFRLKIPIKGKPAPAVT
WKKGEDLTLTESGRVAFEATAINTTLLVRDCHKDDAGKYTITLKNVAGSKEGTITMKVVG
RPGIPTGPVKFDEVTADAMTLKWGPPKDDGGSEITNYILEKRDNVNNKWVTCASAVQKTT
FRVTRLHEGSEYTFRISAENKYGVGEGLKSDPVIARHPFDVPDAPPPPKIVAVRHDSVSL
VWQDPKKTGGSPITGYHIEYKERNSILWKRANKTPLRMKDFRVTGLTEGLEYEFRVMAIN
LAGVGKPSLPSEPVVALDPIDAPGKPEVISVTRNSVTLIWTEPKYDGGHKLIGYIVEKRD
LPSKTWMKANHVNVQECAFTVTDLFEGSKYEFRIRAKNTAGAISPPSESTGAIICKDEYE
APTIDLDPAVKEGLTVKAGDTITMSAISIRGKPLPTSSWSKAGKDFKPSETVHIETTPMS
STLSIKYAARKDSGEYTITAVNPFGTKQEHVHVKVLDVPGPPGPIEISNVSAEKATLTWT
PPIEDGGSPIKSYVLEKRETSRLLWTQVAEDIQSCRHVVTKLIRGNEYIFRVSAVNQYGT
GEPSQSEPVKMVDRFGPPGPPGKPEVSNITKNTVTVNWKRPADDGGSEITGYHVERREKK
GVRWVRVSKKPVSDLRYKVTGLQEGNEYEFRVSAENRAGIGPPSDVSQPVLTKDAAYPPG
PPSNPRVTDTTKTSASLSWGKPHYDGGLDIIGYVVEHQKEGEDAWVKDTTGTALRITEFV
VANLQPGAKYNFRISAINAAGTGEPAKIPNVEIKEREVAPDFELDAELRKTLVVRAGLSI
RIFVPIRGRPAPEVTWTKDDIPLKARANIENTDSFSLLIITECNRYDAGKYVMTLENAAG
KKTGFVNVRVLDTPGPPINLKPRDISKDSITLQWDMPLIDGGSRITNYIVEKRESTRKAY
STITTKCPKCSLRIPNLAEGCEYYFRVLAENEFGIGEPAETAEPIRASEAPSPPESLNIM
DITRNSVSLAWPKPEHDGGSKITGYVIEAQKKGSTQWTHITTVKTLECVVKNLTENEEYT
FQVMAVNSAGRSDPRESRPVVVKEQMMLPEFDLRGIYQKTVIARAGDNIKVEIPVLGRPR
PTIAWKKEDQLLKQTQRVNVENTATATILTINECTRNDSGRYPVSAKNIVGEVSDVITVQ
VHDVPGPPTGPIKFDEISSDFVTFSWQPPLNDGGVPISNYVVEMRKTDSTSWAELATTVI
RTTYKAARLITGTEYQFRVKAQNRYGSGPAISSENVIATYPFKVPGPPGTPQVIAATKES
ITISWHEPLTDGGSPILGYHIERKERNSILWQTVSKTLISGNIFKSSGLTDGIAYEFRVI
AENMAGKSKPSKPSEPTLALDPIDPPGKPVPLNITRHAVALKWTKPEYNGGFKITGYTVE
KRDLPNGRWLKANFSNILETEFTVSGLTEDAAYEFRVIARNAAGAVSQPSEPSDAITCRD
DIEAPRIMVDAKYKETLVLKAGELFKLEADVAGRPPPTLTWTKEGKELEDTAKLEIKIAD
FSTVLTNKDSTRRDGGAYTLTASNPGGFAKHIFNVKVLDRPGPPEGPLAVADVTSEKCVL
SWLPPLDDGGASIDHYIVEKRETSRLAWTTVATEVPVTKLKVTKLLKGNEYVFRVMAVNK
YGVGEALESEPVLAVNPYVVPDPPKTPEVTAANRDSMVVCWGRPDSDGGSPITNYILERR
DRAGMRWVKCNKRVVTDLRYKVSGLTEGHEYEYRVKAENAAGVSEPSPSSQFYKAVDTVF
KPGPPGNPRVLDTSKSSITIAWNKPIYDGGSEITGYMVEIALPEEDEWKIVTPSAGLKAT
SFTITDLKENQEYKIRIYAMNSEGMGEPAQVPGTPKAEERMLPPEIELDADLRKVVTLRA
CCTLRLFVPIKGRPAPEVKWAREHGESLDKATIESTSSYTLLTVANVNRFDSGKYILTVE
NSSGSKSAFVIVRVLDTPGAPQNLKIKEVTKSSVTLTWDPPLIDGGSKIKNYIIEKREAT
RKAYSTVMANCHKTSWKVTDLQEGCNYYFRVLAENEYGIGLPVETPESVKVSERPLPPGK
ITLLDVTRNSVSLTWEKPEHDGGSRILGYIVEMQSKGSDKWATCATVKVTEAVITGLIQG
EEYSFRVSAQNEKGVSDPRQLSVPVIAKDLVIPPAFKLLFTTFSVLAGEDLKVDVPFIGR
PKPTVTWLKDNVPLRQTTRVNEENTENNTLLTIKEACREDVGQYLVKLSNSAGEATEILN
IVVLDKPGPPTGPVKIDEVTADSITISWEPPKYDGGSSINNYIVEKRDTSTTVWQIVSAT
VARTTLKATRLKTGCEYQFRIAAENRYGKSTYLTSESVVAQYPYKLPGPPGTPNVPQVSK
DSMVVHWNEPVNDGGSKIIGYHLEYKERNSILWVKLNKAAIPDTKFKATGLEEGLEYEFR
VYAENIVGIGKASKTSECYAAHDPCDPPGRPEPIIVTRNSVTLQWKKPEYDGGSKITGYI
VEKKELPDGRWMKASFTNVIETQFAVTGLVENQRYEFRVIARNAAGVFSEPSESSGAVTA
RDEVDPPRISMDPKFKETLVLHAGESFKIDADVYGKPLPTIHWLKGDKELTNTARLDIKS
TDFATSLSVKEAIRVDSGHYVLLVKNVAGEKTASIHVKVLDRPGPPEGPAVVTGVTAEKC
TLSWKPPLQDGGSDISHYVVERRETSRLVWTLVDANVQTLSCKVTKLLEGNEYIFRIMAV
NKYGVGEPLESEPVLAKNPFVVPLPPKAPEVTAVTKDSMIVVWERPASDGGSEILGYILE
KRDKEGIRWTRCNKRLISELRYRVTGLIENHDYEYRVSAENAAGVSEPSPPSIYYKACDP
IYKPGPPNNPRATDITKSSVFLSWGKPIYDGGSEIQGYIVEKCDVSVGDWEICTPPTGIK
KTNMEVEKLLEKHEYKFRICAVNKAGVGEHADVPGTIIVEDKLEAPDLDLDMELRKVINV
RAGGSLRLFVPIRGRPTPEVKWGKVDGDIREAAMIDITSSFTSLVLDNVNRFDSGKYTLT
LENSSGTKSAFVSVRVLDTPGPPINLKIREITKDSVSLAWEPPLVDGGAKIKNYIIEKRE
ATRKAYAAVVTNCNKTSWKISQLQEGCYYYFRVCAENEFGIGLPEETHEPVKVAEVPQPP
GKITVDDVTRNSVSLSWAKPEHDGGSKILQYIVEMQVKGSEKWSECARVKILEAVVTNLT
QGQEYLFRVMAVNEKGKSDPRSLAVPITAKDLVIEPDVRPAFHSYSVQVGQDLKIEVPIS
GRPKPTVTWTKDGIPLKQTTRVNVIDSPNLTTLSVKETAKDDSGMYEVAVANVVGQKSAS
IEIITLDKPDPPKGPVKFDDISADSITLSWNPPAYTGGCQITNYIVHKRDTTTTVWETVS
TTVARTTLKVSKLKTGTEYQFRIFAENRYGQSFALESDAVVAQYPYKEPGPPGTPFVTAV
TKDSMVVQWHEPVNDGGSKILGYHLEKKERNSILWTKVNKTVIQDTHYKTTNLEEGIEYE
FRVSAENIVGIGKTSKVSECYVARDPCDPPGCPEAILVKRSSITLQWTKPEYDGGSKITG
YIVEKRDLPDGRWMKASFTNITETQFTVTGLTEDQRYEFRVIARNAAGTVSKPSDSTGPI
TAKDEVELPRISMDPKYKDTIVVNAGETFRLEADVHGKPIPTIMWLKGDKVLEDTARYEI
RNTDFKALITVKDAIRIDGGQYILQASNVAGTKSVPITVKVLDRPGPPESINVSGVTCDK
CSLTWAPPIHDGGSDISHYIIEKRETSRLAWTVVASEAVATMLKVTKLLEGNEYIFRVMA
VNKYGVGEPLESAPVLMKNPFVVPGPPKSIEVTNITKDSMTVCWNRPDSDGGSEIIGYIV
ERRDRAGIRWVKCNKRRITDLRLRVTGLTEDHEYEFRVSAENAAGVGEPSQVTPYWKACD
PMFKPGPPTNAHIVDTTKNSITVAWGKPIYDGGSDILGYIVEICKADEEEWSIVTPQTGL
RVNRFEVGKLIEHQEYKLRVCALNKIGVGEAAAVPGTVKPEDKLEAPELDIDSELRKGIV
VRAGGSVRIHIPFKGRPTPEITWSREEGEFTDKVQIEKGLSYTQLSIDYCDRNDAGKYVL
KLENSSGSKSAFVTVKVLDTPGPPQNLVVKEIRKDYAVLTWEPPANDGGAKIKNYVIDKR
ESTRKAYANVSTKCAKTSFRVENLAEGAIYYFRVMAENEFGIGVPVETADASKASEPPLP
PGKVTLTDVTQRSASFMWEKPEHDGGSRILGYIVEMQPKGSDKWSVVTETKVCNAVVSGL
SSGHEYQFRVLAYNEKGKSDPRPLAVPVIASDLTIQPSFKLMFNTYTVQAGEDLKVEIPF
VARPKPTITWEKDGQPLRQTTRLHVEDTPTSTTLYIKESNKDDFGKYTVTATNPAGKATE
NINIIVLEKPGPPQGPVRFDEISADFVVFSWEPPAYTGGCQISNYIVEKRDTTTTTWQMV
SATVARTTIKVAKLKTGAEYQFRISAENRYGKSTALDSKPVVVQYPYKEPGPPGTPFVTT
ATKDHMIVQWHEPVNDGGSRVLGYHLERKDKNSILWTKVNKTLIQDTKCKTEGLEEGLEY
EFRVSAENIVGIGKFSKTSELYFARDACDPPGRPDAIVITRNYITLKWKKPEYDGGSKIT
GYIVEKRELPEGRWMKASFTNVLETEFTVTGLVEDQRYEFRVIARNAAGCISEPSESTGP
IIARDEIEAPRASLDPKYKDVIVVHAGETFVLEADIHGKPVPDIVWSKDGKEFEGPTART
EIKSTIQRTTLTVKDCIRVDGGLYMLKLSNVGGTKSIPITVKVLDRPGPPEGPLKVTGVT
AEKCYLAWGPPLHDGGASISHYVIEKRETSRLSWTQVASDVQALNHKVTRLLPGNEYIFR
VMAVNKYGTGEPLESEPVLAQNPYRPPGPPSIPEVSAITKDSMIVTWGRPADNGGAEIEG
YILEKRDKDGVRWVKCNKKRLTDLRYRVTGLTDGHFYEFRVSAENAAGVGEPSEPSVFYR
ACDAVYPPGPPSNPKVTDTSRSSVSLAWNKPIYDGGAPVLGYIVEFKEATADEWTTCTPP
SGLQGKLFTVTNLKENSEYNFRICAINIEGVGEPATIPGSVAAADKIEPPEIELDADLRK
VVTVRASGTLRLFVTIKGRPEPEVKWEKAEGRLSDRAQIEVTSSYTMLVIDNVNRFDSGK
YILTLENNSGKKSAFVNVRVLDTPSAPVNLVVREVKKDLVTLAWEAPLIDGGSKITNYIV
EKRETTRKAYATITNNCTKNVFRIEQLQEGCSYYFRVLAANEYGVGLPAETSEPVKVSEP
PYPPGKVTLVDVTRNSATIQWEKPESDGGSKITGYVVEMQTKGSEKWSTCTQVKTLEAKI
SGLTMGEEYTFRVRAVNEKGKSDPRQLGVPVVAKDIEIQPSVELLFNTFSVKAGEDLKID
VPIRGRPIPSVSWKKDGLPLRETTRVNVHTSQTSTLLTIKEASREDVGSYELSASSSAGS
TTASITVIVLDKPGPPTALHIDNVSNDNITISWKPPEYDGGCQINNYIVEKRETTTTTWS
IVSATVARTSIKIMRLITGSEYQFRVSAENRYGKSAYIETAPVVAEYPFSPPGPPSTPKV
VHATKAFMIVSWQEPVNDGGSRVLGYHLEHKERSSILWTKVNKTLISDTQMKVTGLDEGL
MYEYRVYAENIVGIGKCSKSCEPVAARDPCDPPGQPEVTNITRTCVSLSWAKPEYDGGAK
ITGYIIERKELPDGRWLKCNFTNVQETFFDVTGLTEDQRYEFRVIARNAAGLFSEPSEST
GPVTVKDDVEAPRIMMDIKFRDVVVVKAGEILKINADIAGRPLPVVSWAKDGKELEGKAR
VEIASADRHTSITVKDCIRRDSGQYVLTLQNVAGTRSLAVNCKVLDRPGPPAGPLEIKGL
TAEKCHLSWGPPQENGGAEIDYYIVEKRETSRIAWTLCEGELPTTSCKVTKLLRGNEYIF
RVMGVNKYGVGEPLESEAVKALDPFTVPSPPKSLEVTSVTKESMTLCWARPDSDGGNEIA
GYVIERREKNSLRWIRVNKKPVYDLRIKSSGLREGCEYEYRVYAENAAGLSLPSETSPLI
KAEDPVFLPSPPSRPKIVDSTRSNITIGWLKPLFDGGSPVTGYTVEYKLTSETDWSTAIQ
GLRGTEYTVIGLTSGAEYVFRVRSLNKVGASDPSEVSEPQVAKEREEEPAFEIDNEMRKT
LIVKAGGSFTMTVPFRGKPVPNVLWNKPDTDLRTRANIDSSDNCTSLTIEKATRNDSGKY
TLTLQNIVNTATLTLVVKVLDSPGPPSNIIVKDVTKESAVLSWEAPENDGGAPVKNYYIE
KREASKKAWVTVTNNCHRLSYKVTSLQEGGIYYFRVSGENEFGVGVPIETKDGTKITEKP
SPPEKLGVASVTKDSVSLVWLKPEHDGGSRIVGYLVEAQEKGQQKWVKCAVVKTTHHIVH
GLKENTEYFFRVFAENQAGLSDPKEMPLAVTVKDQLESPEVDMKGFPNNTVYVRAGSNLK
VEIPLSGKPLPKVTLSKDGVPIRPTMRFNTETTAESVIINLKESVAADAGRYDITAANSS
GTTKSFIKIVVLDRPGPPVGPVVLSDITEESVTLKWESPLYDGGSQVTNYIVLKRETSTA
VWSEVSATVARNIIKIMKLTTGEEYQFRIKAENRFGISDHIDSACVTIKLPYTTPGPPST
PWITHVTRESITVGWHEPVSNGGSPVIGYHLEMKDRNSILWKKANKMIIRTSHFKVSNIS
AGLIYEFRVCAENAAGIGKPSHPSDAVLAIDACEPPRNLRVTDISKTFVSLSWMQPAFDG
GSKITGYIVEKRDLPNGRWTKASFTNVIETQFTVSGLTQNSQYEFRVFAKNAAGSVSNPS
DVLGPITCVDTYGAPEIDVPPEYTEVVKYKAGTAVKLKLGISGKPIPTIEWFRNGKEIQT
SAQISIENTTEFSAILIKDATRLNSGSYELKLKNAMGSASATVRVQILDKPGPPGGPVQF
RTVTAEKITIMWDPPADDGGASITHYIVEKRETSRVVWSVVSEKQEECIVTTTKIIKGNE
YIFRIRAVNKFGVGEPLESDAVVAKNAFVTPGQPGVPEVTMITKQSMTVFWSRPTVDGGS
EISGYYLEKRDKKSLSWFKITKETIRDTRQKVTGLTENSEYQFRVSAVNAAGQGPFSEAS
DFFKAADPIDKPGPPVKLKVVDTTKTSITLRWAKPAYDGGSAITSYAIEKREAEEEEWTV
VSARGEVRTTEYVVSNLQPGINYYFRVAAINYAGQGEPIEMTEPVQAKDILEEPEIDLDV
ALRTSIVAKAGEDVQIMIPFKGRPPPTVTWRKGDKNLGTDERYSIQNTESSTLLTIPQVD
RNDTGKYVLTIENGVGKPKTSFVNVKVLDTPSACQRLHLKNVSRGTVTLVWEPPLINGGS
EVTNYVIEKRDATKRAWSTVTAKCSHTTFKITGLSEKIPYFFRVMAENENGLGEPCETTE
PVKAAEVPGPVRDLAMKDSTKTSVTLQWSKPDFDGGSIISEYIIEKRLKDETEWSFAGTS
KACEFEAEKLKELSVVEFRVSAKNEKGRSDGVTTGPITVKDYIIVPEADLSDIPGGQVTV
RIGHNVHIELPYKGKPRPTMSWLKDNIPLKESEHIRFKKTENKITLSIRNAKKEYGGKYT
LILDNGVHRKTFPITVITLGPPSKPKGPIKLEEIKADSMVLSWGAPEDDGGGEITGYSVE
KRETSQTNWKMVCSSAEKTTFKVPNLVKDTEYQFRIRAENRYGVSPPLNSVEVIAKHQFK
PPGSPGKPVVYNVTADGMTISWDAPVYDGGAEITGYHVEKKERNSILWQKVNISSISSRE
HRITGLMEGLDYQFRVYAENSAGLSNPSDPSKFTLAVSPVDPPGTPDYIDVTRETITLKW
TAPVRDGGSKIVGYSIEKRQGSGDRWVRCNFTDVTECQYTATGLSPGDRYEFRILARNAV
GTISPPSQSSGYIMTRDEAVPPNIEFGAEHFEGLTVKAGESIRLKVLITGRPVPQVTWFK
DGKEIDKRLNLEITSAIGYSTVFVRDASRDHRGVYRVEAKNASGVKQAEITIRVQDTPGQ
VGGPIRFTNITEEKATLWWEPPANDGCAAITHYVIEKRETSRVSWALIEDNCEACSYTAL
KLIKGNEYQFRVSAANKFGVGRPLESDPFVAQPHYTVPDAPGTPEPSNVTGNSITLTWER
PASDGGSDIDQYILERREKKSIRWVRVPSKRPIAETRFRVTGLTEGNEYEFQVMAENKAG
VGPPSGISRLIKCREQVHPPSAPTVVKVTDTSKTSVSLEWTKPVFDGGLEIIGYIIEMCK
ADLGEWHKVNAETCIATKYTVIDLEPNEHYKFRVSAVNGAGRGESCEVAASIQTVDRLSS
PELDIDANFKQTHIVRAGASIRLFIAYRGRPVPTATWSKADSNLNLRANIQTTDSFSTLT
VENCNRTDAGKYVFTVENNSGSKAITFTVKVLDTPGPPGPITFKDVARDSITLMWDAPVL
DGGARIHHYIVEKREASRRSWQIVHEKCTRQICKVSDLAEGVPYFYRVSAENEYGVGEPC
ELTEPVVATEEPAPPKRLDIVDTTRSSVELAWLKPDHDGGSRIIGYRIEMKQKGSDVWVE
AGETKQLTFTVEGLIENNEYEFRVKAKNSAGYSQPREAFSSVIIKEPQIEPTADLSGITR
QLITCKAGSTFTIDIPISGRPVPKVTWKLEEMRLKETDRVTIKTTKDRTTMIVKDSMRGD
SGKYYLTLENTAGVKTFTVTVIVIGRPGPVTRPVEISSVTAESCVLSWREPEDDGGSEIT
NYIVEKRESGTTAWQLVNSSVKRTQIKVTHLTKYMEYTFRVSSENRFGVSKPVESVPVVA
EHPFVPPSSPTRPEVYYVSANAMSIRWEEPYHDGGSKVIGYWIEKKERNTILWVKENKTP
CCECDYKVTGLVEGLEYQFRVYALNSAGVSKASEASRPVLAQNPVDPPGRPEVTDVTRSS
VSLTWTPPLYDGGSKVVGYIIERKPYNEAGDGRWLKCNYTIVSENFFTVTALSEGEAYEF
RVLAKNAAGVISKGSESTGAVACRDEYSPPKAELDAKLKGEVVTVRAGSDLVLEASIGGK
PEPKVFWSKGDKELDPSEKISLQYTSKHAIAIIKFCDRNDTGKYTLTVKNPSGTKHVAVL
VKVLDSPGPCAGKITISRVTEEKCTLAWNSPQEDGGAEITHYIVERRETSRLNWVIVEAE
CQTLSCVVTRLIRNNEYIFRVRAVNKYGPGVPLETEAIIARNSFTIPSPPGVPVAVGVGK
EHVIIQWQKPESDGGSEISTYLVDKREKRSLRWTRVNKDFIIYDTRLKVTGLMEGSDYQF
RVTAVNAAGNSEPSDASQYVLCKDPSYTPAPPSPPRVVDTTKTSISLAWTKPMYDGGVDI
LGYVLEMKEEGTDQWYRAHSTATIRNAEFTVTGLKTSQKYRFRVAATNINGMSEYSESSA
EIEPVERIEIPDLELADDLKKTVTVRAGGSLRLMVSVSGRPPPIITWNKKGVDLASRGII
DITDSYTLLVVDKVNRYDAGKYVIEAENQSGKKSASIIVKVYDTPGPPGSVKVKEVSKDS
VTITWEIPTIDGGAPVSNYIIEKREAAMRAYKTVTTKCSKTLYRISGLIEGALYYFRVLP
ENIYGIGEPCETSDAVLVSEVPTAPQKLEVVDVTKSTVSLAWDKPQHDGGSRLTGYVIEA
SKAGSERWMKVVTLKPTVLEHTIISLNEGEQYLFRVRAQNQKGVSEAREIVTAVTVQELK
VVPAMDLAGIPQKTLHVPAGKPIELAIPISGRPPPAVSWFFAGSKLRESERVKVETVAKV
TKLTIRETTIHDTGEYTLELKNTSGTALERIKVIILDKPGPPTGPIKVVDIDSTFVTISW
EPPEMDGGAALSGYVVEQRDAHRPGWLPVSESVTRTTFKFSKLTEGAEYVFRVAATNRFG
IGSYLQSEIIECKSRISLPGPPGTPEVFDISRDGMTLTWYPPEEDGGSQISGYIVERKEV
RSDKWVRVNKVAVTMTRYRSAGLVEGLEYEHRITAVNARGSGKPSRPSKSAVARDPIAPP
GKPQNPRVTDTTRTSISLAWSPPEDEGGSKVSGYLIEMQKVDQFEWTKCNTTPTKIREYT
LTHLPQGAEYRFRVLACNAGGPGEPAEVPGTAKVTEMLELPDYELDEKYLEGIFVRQGGV
IKLTIPIKGKPIPICKWTKEGNDVSKRAMIATSESHTELVIKEAEREDSGTYDLTLENKC
GKKVVYIKVRVIGTPNPPEGPLEYDDIQARSVRVSWKPPTDDGGADLLGYIVERREVPKT
AWYTVDARVKGTSLVVKGLKENVEYHFRVSAENQFGISKSLKSEEPVVPKTPLHPPEPPS
YPPEILDVTKSSISLTWSRPRDDGGSRVTGYYIERRETSTEKWVRHNKTHITTTMYTLTG
LIPDAEYQFRIVAQNDIGESEPSPTSEPVVCKDPFDKPSQPGEIEITSISKDSITLEWER
PECDGGKDIIGYWVEYRQSGEATWKKCNRERIKDRQFIMGGLLEATEYEFRVFAENETGI
GRPRRTAMAVKTKLTSGEAPGIRQEIKDVTTNLGEPGQLSCQIVGRPLPDIKWYRFGKEL
IQSRKYKMSSDGRTHTLTVLTEEQEDEGLYTCRAVNEVGEIETSGKLLLQAPPQFHPGFP
LKEKYRAGVGSTLRLHVVYIGRPVPAITWFHGKKLLKNTETITIENTEHYTHLVIKNVQH
KTHAGKYKVQLSNTFGTVDTVLNVEIQDKPDKPAGPIVVEALLKNSVVISWKPPEDDGGA
LVTNYVVEKREAKEGAEWQLVSSSISSTTCRIVNLTENAGYYFRVFAQNTFGISEALEVS
SVVVVKTPFEKPGPPSKPVASAVTIDSCVVAWKPPVSDGGSKIRNYYLEKREKKQNKWIA
VTTEEIHETVYTATSLIEGLEYEFRVKCENLGGESEWSDISEPITPKSDVPVQAPHFKEE
IRNLNVRYRGHATFVCKVTGHPKPIVKWFRQGKEILPDGEKVKIQEFKGGYHQLVITDVT
DEDATVYQVRATNQGGSVSGNASLDVEVPAKIHLPKNLEGMGAVHALRGEVVSIKIPFSG
KPDPVITWQKGQDLIDTNGHYQVIVTRSFTSLVFPNGVDRKDAGFYIVCAKNRFGIDQKT
VELDVADVPDPPRGLKASEVSRDSVNLTWNAPANDGGSRVTHYTVEKRATTAERWIRVGQ
ARDTRYTVVNLFGKTSYVFRVIAENKFGQSQPSEPTDPVITKEDKTRTVNYDEEVDEARE
VTTAKAAHSSTKELYDRYMIAEELGRGQFGIAHRCVETVSKKTYLAKFVKVKGADQVLVK
KEISILNIARHRNILYLHESFESLEELIMISEFISGVDIFERLNTPAFEFNEREIVSYVR
QVCEALEFLHSHSIGHFDIRPENIIYFTRRSSVIKIIEFGQARQLKPGDNFRLQFTSPEY
YGPEVHQHDLVSTATDMWSLGTLVYVLLSGLNPFIAETNQQTIENIINAEYNFDDEAFKD
ISIEAMDFIDRLLVKERKARMTAAEALEHTWLKQRTEKTSTKVIKTLRHRRYYQTLVKKE
WNTVVSVARVAWGGAIRSQRGVTVAKVKVASIEIGPITGQIMHVAGEEGGHAKYVCKIEN
YDSSTEVTWYFGVRQLQHSEKYEISYHEGVATMYVKDIAKSDDGTYRCKVANDYGEDSSY
AELFVKGVREASDYYRCRTVRRVKRRVDTMRLLEKPPEFTLPLYNRTAYVGENVRFGVTI
TVHPEPRVTWFRSGQKIKPGDDDRKYTFESDKGLYQLLIHNVNEDDDAEYTVLARNKYGE
DSCKAKLTVVHHAPPEETTLRPMFKRLLANSECQEGHSVCFEIRVSGIPKPTLKWEKDGQ
PLAASPNIEIVHEGLDYYALHIRDTLPEDSGYYRVTATNNAGSTSCQAYLKVERLRYVKR
EYESVEEREKLVRKRIDKTARMAEILSRTEAVPLTQVAQEALRQAAIMYKPAVSTKTVKG
EFELKAEEVKEEKRLRMPYEIPEPRRRAATALEEDQNIKLFVPMSDMKWYKKLRDQYEMP
GKLDRIVQKRPKRIRLSRWEQFYVMPLPRITDQYKPKWRIPKLSQDDLEIVRPARRRTPS
PDYEFYYRPRRRSLSDLSDEELLLPVDDYLAMKRTEEERLRLEEELELGFSASPPSRSPP
RFELSSLRYSAADAQVTADESKRRELKYATYHIPSKEETSATYAELRQRHDRAVYRPTKQ
KERILSEKEDEELLRPVTTSQRLSEYKSELEYMSQEEKSRMRRRREREVTEIISKEEEEE
MEMMRHVHREISPPSRLLRRRRSLSPTYIELMRPVSELVRPRSHPVEEPERRSPTPERTR
PRSPSPVSSERSLSRFERTARFDIFSRYESMKAALKTQKTMERKYEVLTQEPFTLDHAPR
ITLRMRSHRVPCGTNTRFILNVQSKPTADVKWYHNGIEIQESHKIHFTNTSGVLTLEILD
CHIDDSGTYRVVCTNYKGECSDYATLEVTGGEYTTYTSRRRDEEVLRSVIPDLTRTEAYA
VSSFKKVSATEASSSVREVKSELTETRESLSSYEHHASAEKKVSASEERSLEERATRHKF
KTTLLAKILTKPRSITVSEGETARFTCDTDGEPTPTVTWMRAGQMVVSSGRYQVTRTQYK
STFEISSVQSSDEGSYTVVVENSEGREEARFSLTVQRKRVPEKAITSPPRVKSPEPRVKS
PDRVKSPKRVKSPEPSPAPSKAKSTTAGKTPPAETADLQVIAPPKIKQQLKLEASSDKIK
LFCSVESSVLSVREVAWYKDGKKLKEDGHFRFHYAADGTYELKIHDLKESDQGEYTCEIL
GEGGTSKTNFQFVGQTFKSAYSQVSSLTKTQKAETVEVSTQKKSAVTSQEKVVVQEESVK
KSLASEDIKKSYAEVKSTTTKESVTEGQRATLKASIPGASDVKWLLNGIVLTNSEDYRYG
VSGTDHTLTIKKVTRRDEGILTCEGKTEQGIVKCHFEMSISEDRSKVPAFVTQPRSQNID
EGQDVLLTCEVSGDPSPEIEWFKDNQPIALTSNIRINRSKNVYSLSINNAAVSDSGKYTV
KAKNYHGQCSATASLTVLPLIEEPPREVVLRTSGDASMQEGFSSQSFQMSASKQEASFSS
SRMSEMKFESMSAKSMSSMKESFVEMSSTSVMGKSSLTQLESSTSRMIKSGLRGIPPKIE
ALPNDISIEEGKVLTVSCAFSGEPAPEIRWSCKGRDISSQAGRFHVETSEDLTTLIIMDV
QKNDGGLYTLDLENEFGTDSATVNINIRSI
NT seq 106293 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgaaagcaccaacgttcacacagccgctacaaagcgttgtggcactggagggt
agtgccgcaacctttgaggctcatattagtggttccccagttcctgaggtgagctggtat
cgggatggccaggttctttctgctgcaactctgcccggcgtgcagatctcgtttagcgat
ggccgcgctaaacttgtgatccctgccgtgacagctgctaacagcggaaggtacacctta
caagcaaccaacggatctggacaagcaactagtactgccgaactactcgtcacagctgaa
acagcaccaccgaacttttcacaacgactacagagcatgacagcaaggcaaggaagtcaa
gtgcgacttgacgtgagagtgaccggaatccctacacctgtggtgaagttctatcgggat
ggagcagaaattcaaagctcccccgattttcaaattttacacgaaggagacctctacagt
ttaatcatcgcagaagcttaccccgaagactccggaacatattctgtaaatgccacaaac
agcgtgggacgagctacctcaacagctgaactgctcattcaaggtgaggaagaagctgtc
cctgctaaaaagacaaagacaattgtatcgactgctcagattacacaaactacccaaaga
caagccagaattgaaaagaagatagaagcccactttgatgccagaacccttgcaactgct
gagatggttattgatagtgtcactgggcaacagctgccccacaaggcccctccacggatg
cctccccggccggcctcgatgtcgccgactccaccgatcattgccgctaaagtacagatg
gcacgccagcagtctccctcccccgtgaggcagtcgccatctcccgtaagacacgtgaga
gctcctacaccatcgccagtcagatctgtgtcacctgctgctgctgctgctgcagcgggg
aggctctctgtctccacttcacctatccgatctgtgaagtcacccatcatggtccgaaaa
gcacaggcaggagcagcagccgtgggtgctgaggtgctccctccttggaagcaggaaggc
tacgtcgctacctctgaaaccaggatgcaagacaccagagtgactactacccagatgagg
actgaagaaagatgggaagggagatacggcatccaggaacagatcactgtcagtggcgct
gctgcagccgcagcagaggctgcggttggagttagcgccgccgctgcggcttctgcagcc
gccgccgccgccataaccacagaggactttgggaagtcggcagctgttgccacagtcgtt
gccgctgttgacatggcccgagtgagagaacctcttccaagtgctgtagagcaggctgcc
aaaaggacagcagtgacggcagtacacattcaacctgtccaggagcagattaaaaaggag
gctactatagtagttactagtgctacgggaaaagccagagaacaagaggtaatatcaaga
actagagaaggagttgctactagacaagaacaaatacacatcactcaggaaaagattaaa
aaggaaccagtgaaagttccagtccccaaggtcataattgctgctgacacaattaaggaa
caagaacagatttcaagggcaagagaagaaatttctaccagacgagaagaaatccatatc
gctcacgaaaagactaggaaagaagtggtgaagcctgtgaaaccttctgtacctaaagta
gtaattaccactgataaggccaaagtacccaccacagtagtaaaagctacagagggaatt
gctaccaaacaggagcaacaagcctaccttatccaagaaaagataagaaaagaggctgag
aaaaaaatcatagtgccggcagtcgttgctgttgaaaaacgcagggagcaggagaaagtg
tcaagaactagagaagaagttgctgccaaaagagaacaaatccatctagctcacgatcag
attgctgtcggcaaaagggctgaagctgtagccacagttgttcacgctgttgaccaagca
cgcgttagagaaccgagagagccagattatgctgaagaagcttattctcaacaggcgact
ttggagtatggctataaagagcaagctgtaggaaggcgcgttgttgagctttcccccgag
cgtcatgttgtcaccaaagcagtgaaaacggaggaggttcacgttcctccagagacacgc
gtggcagctgccaagaaaacagaaatggccgtttcgacacagattaaaaggactgcagaa
acggctgttgaaaaaactgtccatgtggaacatccacgtccccgtacagcaagccctcat
tttaccgtttcaaaaattgctgttcctaaaccagatcatacttatgaggtttcaatagca
ggatctgctatagcgactctggaaaaggagttgtcagcaacttctgttcccaagatcacc
cgaccggtgaggcctcctcttgccaagtctcctgaacccagagcgatgccagagaaagta
gtctccccaccgtttcctttcgtagagacagctgccgacacctatgagaggcgatacggt
accgaaatgaaaagggaaataggtgtgagcgtggcagctggcctggtgcgggagcacgaa
cacattgaattaatgcaagaaggagaaccagaggtgattgaagctgcccgggttcctgag
ccagcagaagttcctgccacacctccatccatcgtatcagtcctgaaagatgtgactgtc
atggaaggagagtctgtgacgctgcaatgtcgcatctctgcatatccagccccaacaata
gcatggtacagagaagactaccgtattgagagctccatggactttcagatcaccttcgag
gcgggagttgctcgccttgtgattcgagaagcttttgcagaagacagtggaagatttact
tgtacggctaccaatgaggctggaagtgtcagcacttcatgccaccttcttgtacaagtc
tcagaagaatttgagagcaaagaagctgtttctacaaaaatggtcacagaacaaaaacgc
tatgtggagtcaaaagatataacaatggctgaagtcacaatggctgctgaagaggtatct
ggagaagctgcagctccatttttcataagaaaacctattgtccagaagttaattgaaggt
ggatgtgtcattttcgagtgtcaggttgggggcaacccaaagccacatgtttactggaag
aaagctgggcttcctcttactacaggctacaggtacaaagtgcttcatagaaaagaaacc
ggggaatgcagacttgaaatttcaatgacttttgctgatgatgccggagaatacacaatt
gttgctcgtaacaaacacggggaagtttctgcatcagcttctttactcgaagaagctgat
tatgaggtttatctaaaatcccaagaagaagaactatatagaactcaagtgaccgcctac
gtgcaagagccgaaagtggctgcggtggccccaccgacactgtatgctgactatgaaaaa
gaatatgaaagagaacaagcactcattcggaagaaaatggcaaaagatacggtgcttgtc
cggacttttgcagaagaacaggaattccacatttcttcctttgaagaaaggcttatcaaa
gaaattgaatacagaattattaagaccaccctcgaagaactccttgaggaagatggagaa
gagatggtggtggacatctctgaatctgaaacggttgaagcaggatttgaactgcggtta
aagaattacaggatccttgagggaagtggagtgaccttccactgcaagatgactgggtat
cctttgcccaagattgcatggtacaaagatggcaagcgcatcaaacacggagaccattac
cacatggaggtcttgtcagatggcagagctagcttgcgtttacctgttgtcttccctgaa
gatgaaggcatttatactgtctttgccagcaatgtcaaagggaatgccatatgctctgca
aaactatatgttgagccggttggaccaactgggtctccaggttatatcccatctcctgaa
atgattagaagatatcggtctctttctcctcggtccccaagccgttcccctgcacggagc
tcaccttcacgctctccagcacgcaggttggaggagacggatgaagggcagctggagagg
ctttacaagccagtgtttgttctgaagccaacctcattcaaatgtgccgaagggcagacg
gctagatttgacctcaaagttgtgggccgaccaatgccagaaacatactggtttcacaat
ggtcaacaagttctcaatgattacacccacaagatagtgattaaagaagatggcacacag
tccctgattattactccagctacgcctgatgatgccggagagtgggttgtaattgcccaa
aacagagcaggcaaagcgtccatcacaatgaccctgacagtggaagctaaggaacactta
gtgagaccagtatttgtagaaaaactgaagaatgtcagtgtcaaggaggggagtaaactg
gaaatgaatgtaaaggccagaggaaaccctaaccctgacattgtgtggctgaagaacagt
gacatcattgtaccccataaatacccaaatataaaaattgaagggacgaaaggagaagct
gccctcaaaattcagtccacggtcagacacgatgctgcgtggtatactgccactgccatc
aataaagccggacgggacaccacccggtgtaaagtgaatgttgaagttgaattcacagag
ccggaaccggaacggaagctcattattcctaaggggacatacagagccaaagaaattgca
gcaccagaactagaacctctccacctgcgttacggtcaagaacaatgggaagaaggtgac
ctttatgacaaagagaaacagcaaaagccctttttcaagaagaagctcacctctgtcagg
ctcaagcgctttgggccagcccactttgagtgcaggcttacccccattggagacccgacc
atggtcgtggagtggctacatgatggcaagcctctggaagctgccaacaggcttcggatg
atcaatgaatttggttactgcagccttgactatgacgtatcctatcccagagacagcgga
gtgattacctgcagggcgaccaataaatatggcactgatcacacctcagccactctgatt
gttaaagatgagaaaagtcttgtagaagagtctcagctgcctgaaggcagaaaaggtctg
cagcgcattgaggagctagagaggctggcccacgaaggagctgtcaccggagttatagaa
gaccaaaaagtcaaacagaagccagaaatagttttgtttcctgagcctgcaagagtcctt
gaaggtgaaattgcacggttccgctgccgggtgaccggttacccacagcctaaggtcaac
tggtatcttaatggccaactcattcgtaaaagcaaaagattcagacttcgttatgatgga
atctattaccttgatattgtggactgcaaatcatatgatacaggtgaagtgaaagtaact
gcagaaaatccggaaggtaccacagaacatacagtgaaaattgagattcagcagcgggaa
gatttcaggtcagtccttcgccgagcacctgaacctaagcatgaagccccaacgacggag
cccggcaagcttttgtttgaagtccagaaggtggacaagccggtggacaaaacaaccaaa
gaggttgtgaagctcaaaagggccgaaaaagttagccacgagaaagtgtctgaggaatca
gaagaacttcgcagtaaattcaaacgcagaaccgaggaaggctattacgaagcaatcacc
gctgtggagcttaagtctcgtaagaaggatgagtcatatgaagagctgctgaaaaagacg
aaagaagaacttcttcactggaccaaggaactgacagaagaagagaagaaagccctcatg
gaggaaggcaaaatcacgattccgaccatcaaacccgagaaagttcaactcagtccaagc
atggaggctcccaagatacttgaacgtatccaaagccagacggttggccaaggaagtgat
gctcatttccgtgtccgtgtagtaggcaaaccagacccagaatgccagtggttcaaaaac
ggggtgcagattgagaggtcagatcgtatatattggtactggccggaagataatgtatgt
gaactggtcattagagatgtcacagcagaagactctgccagcatcatggtgaaagctgtt
aatatagctggtgaaacctcaagtcatgctttcttactagtacaagccaagcagcatata
gtgttcacccaagagctggaagacataactgctaaggagaaggactccatggcaaccttt
gaatgtgaaacctctgaaccttttgtcaaagtgaagtggtacaagaacagtgtggagatt
tctcctggagacaaatacagaacacactctgacaggaaggctcacttcctttcgatacta
atgatcggcagaagcgatgcagatgattatagctgtgctctggtagacgacgagtctgtg
aaaaccacagctaaacttactgtagaaggtgctgttgttgagtttcttaaagaacttgag
gaccttgaagtaccagaatccttctcaggggaactggaatgtgaagtttcacctgaagat
gtggaagggaaatggtaccataatgatgttgagatcacacccaataaaaaatacacagta
acctcacggcggggtcgccaaatcctcacagttaaggatgttggtaaagaagaccaagga
gaatacagctttgtggcggatgggaaaaagacctcttgtaaactgaagatgaagccacga
cccgtcgctgtccttcagggccttgctgaccaaaaggtctgtgaaggtgacattgtacaa
cttgaagtgaagctctcacaggagaacgttgaaggtgtctggatgaaggatggcgtcgaa
attcaaccaagtgatcgtgtccacatcgtaatagacaagcagtcacacatgctgttaatt
gaagatgtaaccaaggatgatggtggagcatactcttttaacatccctagtctgctgctt
tcaacaactggccgtgttactgtctacagtgtggatataatcgttcctctaaaagatgtc
catgcgattgagggcacaaaagcaatccttgagagcaaaatttcagtccctgatgtctct
tcatctaagtggtacatcaatgatcagcaaataaaacctgatgaccgtgtccaagcggtc
tccaaagggacgaaacaacggctggtgtttaacaggacatatgcctccgacgaaggtcac
tgtaagctggttgttggcaaagttgaaactagctgcaatctcaccattgaacaaattcaa
atcattaagggtcttcatgacatcacctgcactgaaacacagaatgtcacctttgaggtg
gagctgtcccacgcagggattgatgtcacgtggcactttaaggaccaagaactcaaagct
ggccccaaatgcaagatagaggcccatggcaccatatacaaactgacagtagtgagcatg
atgaaggacgacgagggcgaatacaccttttatgctggagagaagaagacctctgggaaa
ctggttgtagcaggtggtgccatttcaaagcccctgacagatctgaccgtggctgagtcc
cagagagctgtttttgaatgtgaggtagctaatcccgactctcaaggccagtggtttaag
gacggaaagccacttactatgacagagcgctgcaaaagtgaatctgatggtttgaagaga
aggcttcatattgcaatcagcaaacttgatgatgttggtgaatatacctttcaagtggca
tcttcaaaaacctctgctaagctgaaagttgaaactgtgaagatcaagaagacactgaaa
aacctgactgtaacagaaacacaagacgcagtattttcagtagaacttactcatcccaat
gtgaaaggtgctcaatggatcaaaaatggcgttgagctacattccagcgacaaatatgag
ataaagatggacggaaccatccacacgctgaaagtcaagaactgtgctgtaacggatgag
tctgtttacagttttaaactgggaaggataggagcgaatgctagacttcatgttgaaact
gttaaaatcattaaaaaaccaaaggacgtgactgctctggaaaatgctgtcgcttctttt
gaagtgagcgtgtcgcacgacactgtcccagtcagatggttccacaaaaacgttgagctc
aagccaagtgacaaatacaggatgatctctcagaggaaagttcacaagctgacgttgcaa
aatatatctcctgctgatgctggagaatacactgcagtagtcggacaacttgaatgtaaa
gcaaaactgtttgtagaaactgtacatattacgaagaccatgaagaatattgaggttgct
gagaccaaaactgcctcttttgagtgtgaggtgtctcatttcaatgtccctgctgtatgg
ctgaaaaacggagtggagattgaaatgagcgagaagtttaaaatagtagttcagggcaaa
ctccatcagctcaacattgtgaacaccagcagtgaggattctgctgaatacaccttcatc
tgcggaaatgacaaagtcagcgccaccctgaccgtgaaaccggtcctgattacatccatg
ctgaaggacatcaatgcagaagaaaaagatacgataaccttcgaggtgactgtcaattat
gaagggatctcttacaaatggctcaagaatggcatggaaataaaatccacggaccgatgc
cagatcagaacaaagaagcttacacactccctttcaataaggaacgtacattttggagat
gcagccgagtactcttttgtggctggcaaagctgtctcagcggcaactttatatgtggaa
gcccgccatattgaattcagaaaacacatcaaagacattaaagttgtggagaagaaaaga
gctgtttttgaatgtgaaatctcggaaccagatgtttccgttcaatggatgaaagatggg
caggaacttcagcttggagacagaatgaaagttcaaagggaaagatttgttcatcgtctt
ctgattacttcaacaagaatgtctgattctgggaaatacacagtagtggcaggaggaaat
acgtccagtgctaatttggtagtagaaggacgtgatgttcgcattagaagccttcagaaa
gatgtccaggtcatagagagacagcgagctgtggtagagtttgaggtcaatgaagatgac
attgaagctcattggtataaggatggaattgagatcaacttccaaattgaggaaagatat
cattatgtggtggaaagaagagtccatcggatgacaatcactgaaaccagatacacagat
gctggcgaatacacctttttagcgggaagaaataggagttccattactctccatgtgaat
gctcccgagccacctgaaattgtcaaagagcttcagccggccacagcagagtcagggaaa
cctgcccgcttctgtgccattgtctcaggcagacctcagcccaagatctcgtggtacaaa
gacgagcagcctctttctccaggctttaaggtcaagttccttcacgatgcccaagaatac
actctgttgctgattgagacattcccagaggacgctgccatttacaccattgaagcaaag
aacgactatggcatcgccacctcttctgcatccctcttggtggaagtcccagaagttgtt
tctcctgatgtagaagtgcccgtttacccacctaccattatcacaccactccgtgatgct
attacctctgagggacagtctactttctttcaatgcagagttacagggacagacctcaga
ataacttggtattgcaaagacaaagagatcaagccctcccgcttctttaggatgactcag
tatgaggacacgtaccaactggaaattgcagaagcttacccagaagacgaagggatctac
acctttgtcgccagtaattctgtcggccaagtgtcaagtacagccaccctgaagctggaa
gctctggaaagagttcttcaggagaagatcgagcagcagattgaaatggaagtgaaagag
atttctagttctgtttttgtgcctgctgaggaagaaagacctgagagttacagcaacggg
ctacagttacctcatagagataaaacagttgaactcatgcctgaaaattcagtttattcc
agcagtttagaagtgaaaagggagaaggaccatgttccaaccttcctcaaacatgtctca
aatgttgaaataagtttgggagaggtagcgaggctttctgttacagtgactgggactcca
aaaccagaaatacaatggtttttccatagtgttcagctcacctcatgtgcagattatgag
ttggtgtctgatgacgaacattatagcctcattgttctttctgcaacatttgatcacgag
ggggaatacacttgtactgctagtaatatccatggacagaccacatgcagtgcttacctg
aaggtaaatccgaaaggagagagtaaggacttggaggctgaggaggccacggagatcccc
cagctgccctactttgttaggaaactaaattctgcccagtgtgtgcaaggtgcttctgct
gtgtttgagtaccaaatgagaggggagccagcccctgagcttcagtggtttaagggcagt
gacccaattttccccagtgaccattacaccattattcataataattcaaatggttctggg
tcactgacagtcaataactgtcagaaaaaggatgctggcttatatttctgcagaggattc
aatcccttcggtgaggccactagcagcgcagaacttcttattcttttagacatcgtgggt
gagtttccagatagggagcaggaagcgatgcataaaaggcgctctaagtcctataaagag
actgcaagtgagcaagccaccgagtcacgcttatatgcggttaaactgccaggtgaggac
cagccacaagggatgtataccattggtatagaagacaggcatgcgttacatagtgaagag
gtagatgctttacatatgtcatcttactcgacagctactgcacagcaggaagcccttcat
acccaacaaacagcattgcttcagtctcaagacgttgaggaaattgttgatgcttcttct
caggccatccaaaagacggttcccacatcttttactgtgagtgaggtgaaggaacatcct
ggtttccttgagcaacattctgagcccattcaaagcccacttgttgctgatttgactagc
tcccagagccaccaggttcctgatatctgtttacctgtggtagaggaaatacaccaagaa
gacaaagaaaaagggctgcaaataaagcagccagaaattatcaaaccgcagtctgctaaa
gaagacaaactacaatttgcttctgttctttctgaggagaaatatttgttgagctcaggt
gaatcagctttgctctcagcccaaggagctggggaagtttcttccaccagtgaacccaaa
catccagcgtctattcctactattgagggcatccaagcattgtctaaggaaacttcattg
gcagttcaggtacagaagatggacaatggcatattagtgcaggaggaaggtcgtttgttt
caatctgttgtagcaactgtgcaacataagataagcgaagctcatacagaagctcttgat
tatgttgacccccctgaagaagtcaactcaactcaagaagcatcaaatgtactatacgtg
cctatgacttcctccaagcaggtgttacccaaagagtccatcttggatgaagcagttgca
gcacaggcagaaggctctttgaaacagaacaggcttgtcaaaacagcctcggttgcagaa
gaaaagcagcagatctccagtgaatgcacagaagagatccctagattagacagcacagtg
atagcagagatcagcagagaggctacaaagccgtggtgcttgcctgtggtgcatggacaa
tccacttttcctagagaagaacatttcagtcctgagttgctgccagatgatgaagcaaca
tccaggaaaagcccgtgtttgctgtactgcttgacaacagaagaacaagcttccacctct
tgtgaagaggctaagcaattccctcctctggacgctgcagtcagtgtcccatctgcccaa
gagcccgtttctgttttgcatcttcagatgaaccaagctgagcagatattacccaaggaa
ggcatttgggctgcacagaaacctgaatgccaaatggctttgcagaaagcagagatcctg
gtcaagcgtgctgtaacttcagaggaaaagaaccagataggcgcagaagtcctggaaaca
tttcagagtgatattgctggggagaagaccttggtggtagctgagtctcagctccgtaaa
tgtctggctgctgtggctgaagaaatgctactgctcaaagagcaggtgctccctgaagga
ggcaaggaacaaaagataaccttgaaaaaggaagactttctaatggttatgcaggtgtca
atgatggctgaaaataaggccttagatgtaggacacactgagccactgaaagacatccag
gccaggagttgcaaggccgtgtctgagcccagcgtgccttcagaatcaacttccattgaa
gaacgaggtattcctatggagaatacagtttttttagaagctgcagagcaagattttgca
gcacgaatccaggaagggcagtcagttaggcttcctttaatactggaagaaaaacaagca
tttgcagaagaacatctagaccagctcccaagaccagaagctgaaaatgcagaggcaaag
aaacatccagcagtgatgaaggagatgtttgaaacacaggaatacaacgtattttctaaa
gaaaccctgctcgcagctgaggttccaatatgctgtagctttgataaggaggctcaaaaa
ggaagtccgctaaaggtagcactggtgagccagcagcacctgttttcccctgatgccctg
aacaatattaaaagtgttgaactaaaaaatgcagaagtgaccagagagcctaaatataca
gtgtgctctggtcttactatgacaggaagttctaactctgctgaaataacccttgctctt
gatggtgtctattctcactccgctaacgtgaaaagcgaattacaagctgcatttcattct
gttgcttatgaagaaaaacacattctcatggcagaggaacagaagggcatgttctgtatt
gattcacctgtgccacaatgtgcccaaatgaagacagagtcaaaaacacatctggagcaa
cttgtgtctgctcaagaagtccaaacgtttaacctaaaggaagaaatcaaagatgtaggt
accactatgctgacccttgatgttccttcagccgcagccccaagagagacaccaacagat
gttctaaaaatgagtgtgaggaaagaagaactttttgaagaaaatgaggaggagtctata
gataaggctagagaacaagaaggtaggcctttgggtgagatttgtcccatcgtgcatcaa
catgttgtagacactgttgttgaggaaggtgagagtgtaagtcttacttctattatagcc
aatgctaaaacggtgaactggtactttgagggtaaacttgtatcttcaggtgatgagttc
aagtgtttgcaagaccatggcacatacacagtagtaatcaaccaggcattcaaagaagta
catcaaggagagtacgcctgtgaggctctgaacgaaggtggaaaaacaacaacagcagcg
aaactcacagttctgaaaagagttgcaccaatactgaggagaaggctggaatcacaagaa
gtagccgtgaaccaccttgccaagttcacgtgcgagactgagatggcaccaaacgtacga
tttcagtggtatagagctgggcgggaaatttttgatggtgacaaatataccatatataca
gctaattatacgtccactcttcaaattccgagacctcaagtaatagactgtggcgaatac
agttgcaaagcttcaaatcagtatggcagtgtaagcagtacagcagtcttaaccgtgaca
gaagcgtttcctccaacgttcctaaccagacccgaatctattactgcttttgtgggtaag
agtgtccggttcctctgcacagtgtcaggcactcccgtgatagacaccgtatggcagaag
gacggtgctgccgtttcttctacggaacgctgcaagattacatcttctgataacaagcac
agcttagaaatagcacaccttgctgtcaatgacagagggatctacagctgcaaagcctca
aacaggtttggagcggacatctgccaggcagagctagccattattgataaacctcatttt
attaaggagctgcagcccgtccagtctgcggttaataaaaagatccatctcgaatgccaa
gtggatgaagaccggaaagtcacagttgcctggagtaaggatgggaagagaatacctcca
ggaaaagactacaagatctactttgaagacaaaatagcatcgctcgacatccctctggcc
aaacttaaagattcaggaacgtacgtgtgcactgctgccaatgaggcaggcagtagctct
acatctgcagccgtaacagtcagagaaccaccgtctttcctgaagaaagtggacccctct
tacttattgactccaggagagtcagcccatcttcagtgtaaaatcaaagggtctcctgag
atccagatgacatggttcaaaaataacaaggagattagagagagcgatactcacagaatg
tcctttgccaacaatgtggccgtgttagatatttttcatgtcaaagttgatgacagtgga
agttactcgtgtgaagcggttaatgatgctggcagcgacagctgtagcactgagattgtt
gtcaaagagccacctactttcgtcaaaactcttgagccggctgaaatagtgagaggaaca
aatgccacccttcagtgtgaggtttctggcactggaccatttgaaatcagttggtttaaa
gacaagaagcaaatccgcagtagtaaaaaatacaggttgacttcccaaaagtctcttatc
tctctggagatttcttcatttaatagtgcagatgttggggaatatgagtgttccatagca
aatgaagttgggaaatgcatttgcagtgcaacatatatattgaaagaacctccatctttt
attaagaaattcgaaggtgttactacgcttgctggagacacggtgactttacaggcagct
gtgaaaggctcacctcctatttctgtcacttggatgaaggagaaagaaataattaaagaa
gataacaaagtcaaagtgacctttgaaaatggcattgcaactttgcaaatctcagatgtc
caaattagttctggtggtaaatatacatgtctggctgagaatgatgcaggaagccaaaca
tgttttggagaattagcagttaaagagcctgccacaattgttgaaagagcagagttcctg
gaggtgacggccggagacccggcaactttggaatataccattgcagggaccccagagtta
aaaacaaagtggctcaaagatggaaagcctctggtttctaacaaaaagtgtaggatcagc
cttaagaacaacgtcgctcaattaaaattctatgccgccgaactgcaagacagtggagaa
atcaccttcgaagtttccaatgacgttggacgcagttcatgcaccaccacatttactgtg
ttagatcgtacccttcctccgttttttactaaacccctgcggaatgtcgagagtgcggtg
ggtggctcctgccacctcaactgcaaagtctcgggctctcaacccataaaagttgcttgg
ttcaaacatgacagagagatcactgccagtgccaagtatacattacgatacgaagaaggc
tccgcgtctttggaaatcaagcatctggataccagtgatgtaggggtgtattcctgtaga
gccacaaactctgcggggacgaaggagacccgtagcactttggctgtaaaagagccacct
agctttgtaacggagcccgagtctcaagacgttgttcccgggtcaacggtgcgcctgaag
agcacctttaaaggaacagcgccattctccgtagagtggtttaagggtgactctaaatta
acaactggtggagcttgctacatcatgacagaagctttgtcaagttacctggaactttac
gcagtgaaacctgaagattctggcacctattcttgtaaagtcagcaatgttgctggttca
gttgcatgtagcgcaaaattgttcgtgaaagaacctgctactttcgtggaaaggcttgag
ccatcgcaactgatcaaaaaaggagaatatgcccagttagaatgcaaagtaaagggcacc
cctgaaattaaaatctcttggtttaaggatgacagggaaattaaggagagtgacaaatac
cagatgtctttggtaggctccaaagcagtactcagtttgttggacatcacagtggaagac
agtggtgaatatatatgtgtggccaaaaatgaggctgggaaagacacctgcagtagtgtt
gtggcagtaaaagaatcaccttattttatcaaggagtttgagcccagggaagtgttaaga
gactcagatgtcatactggagtgtgaggtgttgggttcacctccgtttgaagtctattgg
ctaaaggacaacaaacctgtgagaagcagtaaaaaacacagaattaccatggagcgttcc
ttgattagtctccaggttttcaagtttgactcttcagatgcgggcgaataccagtgtagg
gtaaccaatgatgtaggaagctgtgtctgtagctctgaggtagctctgaaaggaccccca
caatttgtgaagaggattgagaacattagctctcttagaggaggcaccattgtgtttcag
gcaactgtcagaggctccatgccgataacaatttcttggctgaaagataatgacgacatt
gttgaagacgacaacacaaaaatgacttttgtgaacaatgtggccactcttatgatcagg
gccatcgaagtgaaacatgacggaaaatacttctgtcaggctaaaaacgatgctggaatc
cagagatgttcagctttattaactgtaaaagagcctgccacaatcaccgataaagcggtg
tccattgatgtcacagagggtgacccagccaccttgcagtgtagattttcgggaacaaaa
gatatcactgccaaatggttccgagatgggaaagagttgactttgggacccaaatacaag
atcagtgttactgataccgtgtctgtgctaaaggttgtttctgcagaaaagagagatagt
ggtgaatacacatttgaggtttccaacgatgttgggagcagcagctgtaaagctagcatt
aatgttttagatctgatcataccaccgaaattcaccaaaaagctaaagaaaatggatagc
attaaaggctcttttgtgcaccttgaatgtatagtgtccggctcacatccaatcagtatc
caatggtacaaggatggccaagaaataactgctagtgaaaaatacaaatattctttccac
gataacacagcatttttggaaatcaaccagctcgaaggtgcagatagtggatcttacact
tgcgaagcaacgaataaagcaggaaaaaaccagtgcagtgcccatttaactgtgaaagaa
cctccaagttttgttgaaaaaccacagtcacaagatgttataccttctgctagagtccag
ttcaaagcccacgtgagcggtactcctcccatacaaataaaatggttcaaagatagcaaa
gaactcctttcaggagcatctcgctcagtttacaaggatgatacttcaacagtattagag
ctgttttcggccaagacgtctgattcagggaactacatctgccaattaagcaatgatgtt
gggtcaacaacttgcaaagcaactctttttgtaaaagagccccctcggtttatccagaag
cctagcccagtagtagttttgagaaaaggacaagctactagttttgaatgccaggtggtt
ggtacacctgaaatccgtgtcatttggtaccttgatgggaatgaagtattggaccttgat
aaatatggagtttcatttctagacaacgtggctacatttaaagtatccaatgccagaata
gaggatagtgggacttacatttgtgaagctcacaatgacgcaggtagtgaaagctgcagc
attgaactgaaagtgaaagaacctcccacatttataagggagctgaaacctgtggaagta
gtaaaaacttacgatgctgtgttagagtgcgaagtcgcagggacccctccatttgaagtc
acctggttgaagaacaacagtgagattcgaagtggcaaaaaatataccatgactggcaaa
gaaactctattttcccttcaaataatgaattgtgattttcaagatgctggtgaataccag
tgcattatagcaaatgaaggaggcagttgttcctgtagcaccaaagtcagtttgaaagaa
cctccctccttcctaaagaagatagaaaacatccacgcagttttgaaaggttctgctaca
tttcaggctaccgtatccggttctcagcctttaacagtgtcttggataaaagatgaaaga
atccttgaaaatgatgacaacttccacattacctttgagaaccatgtggcaaaactgaag
atcaagcatgttgacctcagccacagtgggcgatacacctgtcaggcaaagaatgagtca
ggggttgagaagtgttttgctttgcttttagtacaagaacctgcacagattgtagaaaag
gctaaatcagttaaagtcactgaaagagacccagtgacgcttgaatgtacggtggctgga
acaccagaacttcaagtcaaatggtttaaagatggaaaacagctcatgcccagcagatat
tacaccatgagttttgacaataatgtggctcgctttaggattgaatcaattatgaaggag
gacagcggtgcttacacatttaaggtggaaaatgagtttggaagcagcacctgcgaggct
gttttgaccgtattagatcaatccattcctccctcgtttatcaaaaaactaccgaaaatg
gataaaattctgggatcatctgttcatatggagtgcaaggttgctggctcactcccgatt
actgcaaaatggtataaggatggaaaagagctaccggacagtgcaaaataccggagtctg
tgccatgagaataccgtgtccttagagatcagtcacgtagagttgaccgattccgccaac
tacacttgcagtgtgaccaatgttgctggaagtgactcgtgtagcaccatcttaacagtg
aaagaacccccaagcttcttggtaaaaccagaaagccaacatgcggtgcccgattcaacc
gtggaattcaaggctgttttaaagggaacgcctccttttaaaataaaatggtttaaagaa
gatctagaacttgtgcctgggccaaactgcttattcggtattgaagggtcaactggtttc
ttaaatctttattcggtggatgtatcaagaagtgggaattatacctgccaagtttccaat
gatgttgggagtgattcttgttcgacaacgctgagcataacagaacctccaaagtttgtt
aagaagctagaggcatcaaaagtggtgaaacagggcgactcgtcacggcttgaatgtaaa
atcactggctctccagaaatcaatgtggtgtggtacagaaatgatatggaactccatccc
ggcgaaaaattccagatgtcattctcagactctgttgctgtcattgaaatgagacatctt
ggtgctgaagacagtggagattacatatgcgaagcgcagaatcctgctggcaagactagt
tgcagtacaaaacttctggtgaaagaacctcctgcatttagcagaaagccatctccagta
gatactctcaaaggcaccgaagttagccttgagtgtgaaatttctgggactccacctttt
gaggttacgtggtacaaggataagagacaaattcgcagcagtaaaaaatacaaggtcacc
tccaaaaactaccatgcaagtgtccatattctgaatattgaagctgcggacattggtgaa
tacctgtgcaaagctcagaatgatgttggaagtgacacttgtatttgcactgtgaaactg
aaagaaccaccaaaatttgtgaccaagataaacaacctcactgttgtggtgggcgaacca
gtagagttacaggcgacggtggaaggttctcaacccatttctgttgtatggctcaaggac
aaggaagtcattcgagaaagtgaaaacagaacaataacttttgtggaaaacactgccact
ttacaacttgctaaagcattaccagcaagtgccgggaaatatatttgtcaaatcagtaac
gacgctgggacccgggagtgtataggcacattaactgtcttagagccagccatcattgtt
gagaaggcagagccgatgaaagtcaccgtaggagatacttgtacattagaatgtaaagtg
ggtggaacccctgagctttctgtaggctggtttaaggatggaaaagaactgacaagtagt
gagaaatacaaaattaccttctacaacaatgtgtctaccctcaaaattcttgattcggaa
agtgaagacagcggcttatatacctttgaagtgcaaaacaatgtgggcaaaagtggctgt
acagcttcagttgatgttctagatcggatcattccaccttctttcacaaggaaacttaaa
gaaacacacggtgtcctgcattcttccatggctctcgaatgcaaagtggccggatctcca
cccatgacggtggcttggtttcataacggtcataaaatcactagtggggaaaaacatcaa
atcgctttttcagacaatatttgcggtttacaaatcaattccctgagtccatcagataca
ggaacctacacatgcaaagctgctaatgtagcagggtctgctgaaacaaaggccgttttg
actgtacaagaaccaccctcttttgtgaaagaacctgaaccagtggagattttaccaggc
agaagtgttacattttcagctgttgttagaggaacgccaccattaaagatgaaatggttc
aggggggtcaacgaacttgtaaccggcgataaatgcaacatccgtctggaagatacagtc
acaaagctggagctgtttgctgtagagccatcccagagtggagagtatagttgcgtcgtg
actaatgatgcaggaaaagtgtcttgtacaacccgtctttctgttaaagaaccagcagtt
tttgtgaagaaactaagtgaccattgtgtggaaccgggcaaatccataattctagagagc
agatacactggcagcttgccaatttcggtgatgtggaagaagaatggtgcgattttaagt
caatctgaaaagtgcagcatcaccacaacagagaagtcatgcatcctggaaattcttaat
agtacaaaggatgaccaaggagaatacacatgcatggtggaaaatgaagctggaggagat
gtgtgtgaagcactggtgaccactttagaacctccttctttcgtcacacatttgggacct
cttgaggtatccgtcggagactacacaaccttgcaatgccaagtttctggaacaccagaa
atcaccatctcttggtacaaaggagacaccaaattaagatctactcctgagtataaaatg
tatttcaaagacaacgtcgccacactgatatttaacaaagtcgatgtcagtgacagtggt
gaatatatttgcaaagccgaaaacagtgttggaactgcctcgtcgaaagccactttgtca
gtgcaagagaggaaacgtccaccttcgtttgcaaggaaattaaaagacacagagcaaaca
cttggcttcccagtcaaacttgtttgccgcctaaatgggtcggaaccgatcagtgtcaca
tggtataaagatggtgtgcctttgagagatgactttaatgtgcagacctcttacattgat
aatgtggcaactcttcatctgttacaaaccgagatgggccatacggggcagtactcgtgc
acagctaccaatcctgttgggacagctacttctagcgctaggctccaagtcacagaaccc
aggcaagctcccttgttcgatatcacgcctgaatccaaggacgttccagttggagaaagt
gttgacttggagtgtcatgtcaccggagcccaaccaatacatgtcgcttgggcaaaagat
ggccgagagattcgtacaggaggaaactatgctatcacatttgcagcaaatacggcccac
ttgaggattctgagagtaggcaagggagactctggacagtatacctgccaagctaccaat
gatgtcggaaaagatttttgctctgctcagcttaatgtgaaagaacctcctaagtttgta
aagaaactggaagcaacgaaaatggtgaaacagggtgattcctgtcaacttgaatgtaag
atcagtggctccccagaaatcaaaattgtgtggtacaagaatgaccacgaaatccatgcc
agcgacaaacaccacatggcattcagtgactccactgcagcccttgtcatcgtggacgcc
aaccctgaagacagtggagattatatttgtgaagcggtcaattcagccggcacggccagc
tgcagtacgactgttatagtgaaagagcctcccgtttttagcaagaaaccttcccccgta
gacacccttaagggctctgacgtcatccttcagtgtgaaattgtaggcacaccgccattc
gaagttgcctggttcaaagaccgaaagcaggtcagaagcagcaagaagttcaaaattacc
acaaagaacttcagtgccagcgtccacattcttaacttggaagcggcagacactggggag
tatcagtgcaaagttgccaacgaggtgggaagcgacacttgctcctgtgctgtgaagttc
aaagagccgcctcggtttgtcaagaagttgagtgacacttccacatactctggggaaccc
accgctctgcgggctgtcgtggaaggctcccagcccatttctgtcctctggctgaaggac
aagggcgaaataatacgggagagcgaaaacgtccaaatttccttttcggataacatcgcc
actcttcagatcgccagcgctgaggccactaacagcgggaaatatatctgccaaatcaaa
aacgatgctggaatgagagaatgtgcaggatatttgcaagtcctagaacctgctgtgatt
ttggagaagccggagcccatgacagttacagctggcaatgcctttactctggagtgtact
gtgggtgggacgcctgagctcgttgccaagtggtttaaggacggcagagaactcgccagc
agccgcaagcatcagatcacctttttcaacaaagtagccaccctgagggtgctctcggcc
aacatggatgacaggggcttgtactctttcgaggtgcaaaacgaagtggggaaaagcagc
tgcactttgtcagtcaacgtctcagaccagatagtccctccttcttttgtaagaagactg
aaagaaacctttggggtgctcggctcttccgttgttttggaatgcaaactcgccggttcg
ccaccaatgtcggtgacttggttttatggaggaaatgagattttcagtggggataaatat
gagactgctttctcagatgatgtctgtgctttgaaagtgaatgctcttgactcatccgat
actgggccctacacctgtgcggccacaaacgcggctggttcagacgaatgcagtgccttt
ttgacagtgcaagagcctccctcttttgcaaagacgcctgacccattggaagtgttgcct
ggaatgagcgtaaccttcaggagcattatgagaggaactcctccctttaaagtgagctgg
tttaaaggaagccgagagcttgtgccggggaagacatgcaacatcaagttggcagataca
acggcagagctggaattgtttgacgtaggccctctccagactggggattatacgtgcctt
gctgcgaacaatgccggcagtgcttcttgcaccacacatctttttgtaaaagaaccagcc
gtgtttgtgaagaaactcagcgacttcagcgtcgagcaagggaaatccattattctagaa
agtacattcagtggaactcctccgcttgccgttacatggaagaaaaatggcatgaacctt
acacagtctcccaaatgtaacataacaacaacagaaaaatcaggcatcctggaaattctt
agtagtaacagaggagatgaaggagaatacacgtgtgaagttgcgaacgatgctggggag
gacacatgccacgctatggtgtccatcttagaaccgccatattttgtaaagcacttggag
cgtgtggaggtgacggtgggagagcctgcgtctttacactgccaagtggctggaactcca
gagataaaagtgtcatggtacaaaggagacaccaaactaaggtctactcaggcttataaa
atgcacttcaagaacaacatggcttccctgacgttcagccaggtggacaatactgacatc
ggggaatacatctgcaaagcagaaaacagcgttggctttgccacgtccacagcggtgctg
acggccaaagaacataagcttcctccgacatttacgagaaagctgaaagatgtacaggag
accgtgggctctccggtcgcttttgattgccgtatcgttggctccgaaccgattgaagtg
tcttggtataaagataaggtcctgttgcatgatgacgataacattcagacagccttctta
aacaatgttgcgactcttcagatcttgcaaaccgacatggctcactgtggccaatacacc
tgctcagcccacaacgcgctcgggacagcttcctccagtgccaaactgcacctcacagag
catctaaagcctcccttctttgatgtgaagccttcacctcttgatgtggcacttggggaa
agcgctgctttcaaatgccatgtcacagggtcaatgccgatgaaaatcatctggacaaaa
gataacagagaaatccggccaggtggcaattacaagatcacgctggtagaaaacacagcc
acgctgacttttcttaaagtcggcaaaggtgatgccggactttatacttgctatgcaagc
aacagtgccgggaaggattcttgtgcggctcagctgagcttcaaagagccaccaaggttt
attaagaaattagaaccctccagagtggtgaaagaacatgactcagcaagatacgaatgc
aagataggaggctctccagaaattaacattgtgtggtacaagggcgaaactcagattcat
cccagtagcaaatacagcatgtcgtttgtggattctgtggcggtgattgaaatgcacaac
ctgagtgtggaagacagcggagactatacttgtgaagcccagaatgctgccggtagtgcc
agcagcagtacgtccttgaaagtgaaagttccaccagttttccacaagaaaccccggcca
gtagaaatcctgcgaggttctgatgttcacttggaatgtgagctccgaggcactgccccc
ttccaagtttcgtggtacaaggacaaaagggagatcagaagtagcaagaagtacaaaatt
ttggctgaaaattacttggctagtcttcacattctcaatgttgacgctgctgacatcggt
gaatatcactgtaaggcagtcaatgacgtgggaagtgatacttgccttggctctgtgaca
ctgaaagtaccacctaagtttgtgaagaaactccatgatgtcactgccgtagttggagag
ccagctgagctgcaagctacagtggaaggctctgagcctatttctgtggtttggctgaaa
gataaaggtgaaattatccgagaaagtgacaatgtctggatgtcatattcagataaagtt
gctatccttcaagttgtaaatacggagccaaccaacactgggaaatacacctgccagatt
aagaacgatgctggaagtcaagaatgtttcgcaactttgtctgttctagaaccagcatct
attgtagagaagccaggaccaatgacagttacagctggagattcctgtaccttagaatgt
accgtagctgggacgccagaactctctgctcggtggttcaaggatggacacgagctttct
tcagaccacaaatacaaaatcactttcttcaataaagtggctggacttaagattctcaat
acaggactagaggatagtggagagtatacatttgaagtgaaaaacaatgtgggccaaagc
agttgtgcagcatcagttcatgtttcagaccgcattataccaccttccttcacgaaaaag
ctgaaagaaacgcatggcctcttgggttcatctgctgttcttgagtgcaaggtcattggc
tcacctcctatctctgtttcttggttccgtgatggttatgagatcacgagtggagacaaa
taccaggcaaccctcacagaaaacacttgttctttaactgtgaacactcttgaggagtcc
gatattggaaactatacttgcatagcgacaaatgtagctggatctgatgaatgtgatgca
tatttcatagtaagagaacccccctcttttgtgaagaaaccggaatctttgcaagtttta
tcaggggcaaatataacattcaccagtctcctgaaaggaacccgcccacttgaagtgaaa
tggtttaggggtagtgaagaactagtcccaggacacagatgtaacatctctctcgaagaa
tttgttgccgaactggagttgtttgatgtccatccagtccaaagtggagactacacctgc
attgttacgaacgaagctggcaaaatctcttgcacggctcacctctttgtcaaagagcca
gccaaatttgtgaagaaattgaatgacctcagcattgacaggggaaagcaaattatcctg
gaatgcacctttacgggtacccctccgattgctgtctcctggaagaaaaatggtgtaaag
attgcacagtcagagaaattccatattaccactacagaaacatctgccatactggaaatt
tcaagcagcaaattggatgatggtggcctctattcttgtcacatagaaaatgattcagga
caagataattcccaggctactgtctcaatcttagaaccaccttactttgtcaaaaatttg
gaacctgttcaggtgactattggagattctgcatcattgcaatgccagattgctggaacg
ccagaaatcattgtatcgtggtacaaaggagacaccaaactaagagcaaccgataccact
aaaatgcactttaagaaccacgtggccacactagtattcaaccaagtggacagtcacgat
agtggggagtatatctgcaaagcagaaaacagggttggggaagctgcttcttcagcgctg
ctatctgttcaagaacgtaaacttcctccttcattttcacgacagttgagagatattcat
gaaactgttggcttaccggttacatttgattgtggcattactggttctgaacctattgaa
gtaacgtggtttaaagatggtgcacaaataagagatgggtataatgtgcaaacatcgtac
ttaaataatgtagcaactttacagatttctcaaactgacatgagtcttgctggtcaatac
acttgcacagcttccaatgctattggaacagcttcctctagggccagactcatccttaca
gaagggaaagctcctccattctttgatatccccattgcctctgtcgatgctgtcgctggt
gacagtgctgattttgaatgccatatttctggaacacggcctattaaggtgacatggtca
aaggataatcgagaattacgaactggaggaaactaccagatcagttatgtggaaaatata
gctcacttaacaatcttgaaagttggaaaaggagactctggaaaatattcatgtcacgct
agcaatgaagttggaaaggaatcttgcacagctcaacttaacattaaagaacggcagatt
ccacccacttttaccaagaagttgtctgaaactgtagaagaaacagaggggaacaccttt
aaactcgagggccgtgtttctggttcccagcctatgactgtatcctggttcaagaacaac
cgggagatttatgcaagccagaattgtgaactgtcattccaaaacaacgtaactcttctg
cacattaaacatgcaggacaggctgatgcaggcttgtatacctgcaaagtgtccaatgaa
gctgggagtgtattgtgcacttcatctgttgttattaaagaacccaaaaagccaccagtc
tttgatcagcctctcaagccggtgacgatagacgaaggcaagatcttacagctcagttgc
catgttcagggatcacagcccattagaatccagtggctaaaagctgggagagaagtgaga
tcctctgataaatgcagtttgagctttgctaatggaacggctcttttagaagtccaggca
gtgagtaaaatggattctggagaatatgtgtgcaaagcttcaaatgtggctggaacagac
tcctgcaaatccaaagtgacaatcaaagaaaaaccagcagctgccccagcggctaagaaa
gcaccaacggatggaaagctttattttgtctctgagcctcaaagtatcacagtcattgaa
aagagtgttgcaacatttattgctaaagttggtggtgatcccatcccaaatgtgaaatgg
atgaaaggaaaatggaggcaactgaaccaaggtggccgcattatcattcagcaaaaagga
gatgaagccaagctggaaatcaaggatgcaacaaaaactgattctgggcagtacagatgt
gtggctttcaacaaacatggcgaaattgaaagcagtgcaaacttacaggttgaggaaagg
aaacaagaagtagttgaaggtgatctcagagcaaaactaaagaagactccaacaaaaaag
aaggaagatgaggaagaaaaggctattgatattatggaattactaaaaaatgtagatcct
aaagaatatgagaaatatgcccgtatgtatgggattacagatttccgaggtcttctccaa
gcctttgagttgctgaaacaaagccaggaagaagaaacccatagactggagattgaagta
agagagagatctcgaaaggaagagcaagaatttgatgagcttgtatcattcattcagcaa
agactgacgcagacagagcccatcacactgattagagatatagaagataagaccgtatta
acggatgaagatgccgtctttgaatgtgagattaaaataaactatccagaaattaaactg
tcctggtacagaggcacggaaaagctagattctaacaacaagtatgaaataagaattgaa
ggtgaccgacacatacttagaatcagaaattgtcagcttggagaccagggaaattacaga
gtcgtctgcgggccacacattgcaagcgcgaagctcactgtgatcgaacctgccattgaa
cgacctctgcgtgacacggccctcaaggaaggctttacgtgctctttggtttgtcagttt
tctgttccaaacgcaaaatcccagtggttcagagatggaaagccccttaagataggtggc
cgatactcgacagaagtctcagagaaagtccacaggctcattatcaaggatgtgagaaca
gaagaccaagggcactatacctgccgatttgaacggaacctagaaacaagcgccagtctc
acaattgaagctgaaccgatacagtttacaaagaccattcagaatatcgtggtgagcgaa
taccagtctgcgaccttcgagtgcgaggtgtcttttgacaatgcagtcgtcacatggtat
aaagagaaaaccgaactccgggaaagccacaagtacagctttaggagcgaagcccgttgc
cattatatgactatccacaacgttactgcagatgatgaaggggtgtattctgtaattgct
cgccttgagccaagaggtgaagcacgaagcactgccgagctctacctgacgacgaaagag
attaaactggagatccggcctccagatgtcccggatgctaaagttgctgttccagtcgaa
gctccaactgaagaagttcctgctcttcctatcttcattcccctgccggaagagaagaag
aaggaaaaagtggtcaaaaagacaattgtaaagaaagtcaccaaaaaggaggttcctaaa
cctccagaggaggtagcacctcctaaagttcctgtcaagaaacctcaagaggtcaaagta
gtcgctgtgcctaagaagaaagaagaagcttatgagaaaaaggaggaaatctatgaagtt
cacagagaagcatatgaagaatgggaagaggactatggagagaaatatgagtattacgaa
agagaagaaggttatgatgaagaggaagaggaatggcaatatggagaaagagaagtgact
tatgaggaaaaacaatatcatgaagaagtggttcatgttccaagaaagccagaacctgta
cataaaccaccagaaatttcaaccaagagagaagaaaagaaaaaagtagttgtacaaaaa
gttacacgaaaacctgtagtggaagaggtggaaagagctgctcagagaatggaagaggag
aaagttaaacgaatcagagctcctgaagtcccaccagaaaaacctgcccggaaggtagtc
cacgaggaagttatagaaagaaaagtaccagcggaagaaaagtggactatttcagaagaa
aagatatctgtttcataccaccgagaagaagaatacacatattcagaaccggaagagtat
gaagaggatagcgtttatgtggaatatccaactgaagaaccagaagaatatgaagaagaa
agatactacgtggaagctcctgaagttccaccacctaaagttcctgaggtccatgtgaag
gtaaaagagccagttcctgttcccaagaaggtggagccaccaccacctaaaatacctgag
gtcccaaagaaggttgtcccagaaaggaagaaacccactcctccaccaaaaccagaagct
ccaccagctaaagtgccagaggtacctaagaaacctgttccagaagaaagaaaacctaca
gctgttcctaagaaagaagtgccaccaccacctaaagtccctgaggtacctaagaaggtt
ccagaggtacccaagaaggttccagaagagaaagttcttgttccaaagaaaaaagaggct
cccccagccaaagtgcctgcggtacagaagaaagtcacccctgaggaaaagctaccagtt
gctgttcccaaaaaggtggaagcacctcctgccaaagtgcctgaggtgcctaagagagct
gttgtagaagagaaagtatttgctgcagaagaaaaaatatcttttgccatttctaaaaga
gtggaagctccttctcctgaagtggaaaaatgggctgaagaagtggcggaggaagaggtg
gaagaagaggaagaaactgtttcttatgaaagagaggaggaaatttcttatgaaagagag
gaggaaatttcttatgaaagagaggagatttcttatgagagagaggagatttcagaagag
gcctactacgctgaggaagtggtacatgttactgttcccgaggaagcaccaccagctaaa
gtgcccatgatccggaaaagaccagaacctgaaaagaaagcacctatggctgttcccaag
aaagtggaagctccaccaccaacaatagtgtccaagaaaattcctcctgaagaaagggaa
ccacctaaagtaaaagaacctccaccaccaaaagtgattgaagtccacaagaaaaaggtt
gtcactgaagaaaaaatagctgttactaaaaaggaggaggctccacccaaaagagtgcca
gctgtagcaaagaaaccagtgccagaagagaaggtccctgtaccagttcctaagaaaaag
gtggcaccacctgcaaaagtgccggaagttccaaagacaatgatctccgaagaaaaagta
tctattgctgttccaaaaccaaaaccacctcctcccacaaaagctgtagaagagcgatgg
ggatatgcagaggaagtgtctgttactcttcatacagaggaggaagtctcttatacagtc
cctgaagaacctgagaggattaccaaaaaagaaagactaccaataacaatagctacaaaa
gtgaagaagcctccgacgaaagcaccagaggttcgtaaagctgttgttgaaaaagaagtt
gtccatgtagaagtttctccgtatgtggaggaggaggaggaggaagaggaagaagctact
ccatatgaagaagtgccacctcagtatgaagaggaggaagtggcagaatatgaagaagaa
atatctcggtatgaagaggaagttacccgctatgaagagaaagtcagccagtatgaggag
gaaataactcactatgaggaagaggaagaagttcctccttatgaagaagttcctgaatat
gaagaagaggaagaggtccctccaccaccacctcctccagctaaagtgcctgaagtaccc
aagaagcctgtgcctgagaaaaaggttcccgcggtgcctgtacctaagaaaaaggaagct
cctccagcgaaagtgcccgaggtgccaaagaaacctgtaccagaagaaaaggtgccggtg
ccgaaaagaaaagaagctccacccgccaaagtgcctgaagtaccaaagaaagttgttcca
gaagagaaagtgcccgttccgatacctaaaaaagtggaagctcctcctgctaaagtgcca
gccgtgccgaaaaaacctgttccagaagaaaaagtacctgctgcagttcctgaaaagata
aagccccctcctcccaaagtgcctgaggtacccaagaaaattgtgacagaagcaaaagtg
cctctcgcggtgcctaaaaaaccagaacctccaccagctaaagtgccagaggtacgaaag
gagcctctcccagaagaaaaagtccccatcttcgtgcctgaagaagaggaaccagtacca
gccaaagtcccagcagttccaaagaaagttgtcccagtaaagaaagtacctgaagctgtt
cccaaaaaagtggagccaccacctcctcctcctcctaaagtgcctgaggctcctaagcct
gtcccagaagagaaagtccccgttcccaaaaaggtgccggcgcctcctgcaaaagtgcct
gaggtgcccaagaaagttgtccctgaaaagaaggtgccagcccctcctcctaaaaaagtg
gaggcaccacctgcgaaagtgcctatggtacctaagaaacccacccccgaagaaaggatc
attgttcctcctccctctgttgaaaaatatgtttatgaagaatatgagaaatatgaggcc
tatgagaagatcgaggagtttctgcaggtggaagagggcgaagaaccagaagaatatgag
gaagctcctgaaccagaagaatacgaggaagctccagaacctgaagtatatgaagaagct
ccggaagaacctcaagttgaagaatacgaggaagctccagaaccagaggaacttgagtat
tatgaagaggttcaagagacaaaggagatagaagaatatgaggaggtgtatgaggttcca
gcagcaatagtacctgcagtgccgaagaagccagtcctagaagaaaaagtacctattgcc
gttcctaaaaaagaagcaccccccacacctaaagtgcctgaagtgcctaagaaagctgtc
cctgaggagaaaatgcctaaagctgttcccaagagaaaagagccttcaccagctaaagtg
attgccgtgccgaagagaggtgtccctgaagaaaaaatacctatcattgaagaaaaaata
cctatcactgccggtgaaccagaagaacttcccacagtggaagctcctgctgttcatgag
aagattttatgggaagaacaagttacatatattattcccagggaaaaggaagctatttca
gttgaagttcttgaatggaaagaggaagttctcgtggaagaaaaggctcctgctggcatt
cccaaaaaaccgaaagctccaccagctaaagtgcctccaacggtaaagaaaattgtgcca
gagaagaagaaaccaacggctgaacctaaagaagaagcaccactcattacagggactgag
gtacgaaagaaagtcatatctgaggaagaactaccagctccagtatctaggaaagaagtt
atacatcatgaagtggcagaaacatatgaggaaatacttctagaagaaaaagaacaaaga
gttccagccgccatttctaggaaacgagatgttccgcctaccaaagtgtcagaagtggcc
agaaaaggagtggcagaagagaagacatctgttgccaaactcgaaaaaccagagccagtt
tccatccataaaaaagcagaacctaccgtggcacctaaaatagcacaacctcaagtgctg
gaagaaaaaagggttgttactaaaccctccaaacctgaacctgttgttgtgccaaaacca
gcagaggccaaaaagaagatagttgcctcaaaacccacaaaaccagagcctggtgtcgtg
gtggaaacaacagaacctcaagtggcagaaaagaaggtagccgttgctaaaaccagaaaa
atggagcctgcggtggtatctaaaaccaaggagtctgtaacgttagaagaccaagtagcc
gagaaactagaacacactgtggtgcttgaaagagtacaggctgaagaaaagaggacagtg
aggaccaaaccgaaaaaagcggagactgtcaggatgccccaagaaggagagcctcaggtg
ccaaaggagaaaataagagtcgccaaacccggaaaaccagaatctgttgtagtgccagaa
tcaatagagcatgaagaggaagtagaagaagaagtgattgccaaaccaaggaaactggag
cccacagtggtgcctgaagtggaagaagaagagatagatattactgaaccctaccacgca
gaacgaattgtggtgcttgaaacaacagaaccccaagtggcagaaaagaaggtagccatt
ggtaaaaccagaaaaatggagcctgtgatggtttctaaaaccatggagtctgtaacatta
gaagaccaagtagccgagaaactggaacacactgtgatgcttgaaagagtagagactcaa
gtgtcagaaaagaggacagtaatgaccaggcctaaaaaaacggaggctgtcatcgtgccc
aaagaagaagcgcctcaagtgcaaaaacagaaaataagggtcaccaaacccagaaaacca
gaatctgttgtagtgccagaatcaatagagcatgaagaggaagtagaagaagaagtgatt
gccaaaccaaggaaactggagcccacagtggtgcctgaagtggaagaagaagagatagat
attactgaaccctaccacgcagaacgaattgtggtgcttgaaacaacagaaccccaagtg
gcagaaaagaaggtagccattggtaaaaccagaaaaatggagcctgtgatggtttctaaa
accatggagtctgtaacattagaagaccaagtagccgagaaactggaatactctgtgatg
cttgaaagagtagagactcaagtgtcagaaaagaggacagtaatgaccaggcctaaaaaa
acggaggctgtcatcgtgcccaaagaagaagcgcctcaagtgcaaaaacagaaaataaga
gtcaccaaacccagaaaaccagaatctgttgtagtaacagaatcaatagagcttgaagag
gaagcagcagaagaagaagtgattgccataccaagcaaaccagagcatattgtagtgcct
gaagcaacagaaacccaagtggcagaaaagaagatagccattgctaagccccccaaaatg
gagcctgtaagagcagagactcgggtttcagaaaagaagacagtaatgaccaaacctaaa
aaaattgaagctgtcgtggtgcccaaagaagaagagcctgaagtgcaaaaacagaaaata
agagtcaccaaacccagaaaaccagaatctgttgtagtaacagaatcaatagagcttgaa
gaggaagcagaagaagaagaagtggttgtcataccaagcaaaccagagcctacggtggtc
cctggagtggaagaagaagagatagctatgactgaaccccccaaagcagaacgaattgtg
gtgcttgaaacaaccgaaccccaagtggcagaaaagaaggccaccactgctaaacataaa
aaacctgcacctgttatggtgcctaccatagtagaacctcaagtgccaaaacaaaagata
gctgttggcaaacccaagaaacctgaagctaggcctaaaccactagagcttgagatggaa
gaagagcacgtgactgttgttgagctcagagaaagagaacatacagtcattcttgagaca
gcagagccctatgtggcagaagaggagccggttcttgcgaaaccgaaagaattagagcgt
gatactgtacccgaacccgtagaacttccagcattgaaagtgcctgaagtacctaagaaa
gtggtcccagaaaagaaggttgtgccagaagcacctccagaaaaagtgcctgaggtacca
aagaagctggttccagaagagaagattgtgcctaaaaaaccagaggcaccaccagctaaa
gttcctgaggtaccaaagaaacctgttccagaagaaaaagtcccagtggctgtgccaaag
aagccagaacctccaccggctaaagtgcctgaagtgccagagaaagttgttccagaaaag
aaggtgccagctgaagtgcctaagaaaccagaagctccacctcccaaagttcctgcggta
cccaagaaagtggtccctgaagagaaagtacctgctcctgagctcaaaaagccagagcct
ccccctgctaaagttcctgaggtgccaaagaaaatcatcccagaagaaaaagtccctgcg
agagagcctgaacctccagcacccaaagtgccagaagttccaaagaaagtcattccagaa
aagaaacctcctgaaccagaggctccgcctgctaaagtgcctgaagtgcccaagaaaatt
gtcccagaagaaaaaatacccaagaaacctgaaccaccacctgctaaagtgcctgaagtg
cccaagaaggttgtgcctgaagagaaggtccctacactcaaaaagaaagagccaccaacc
cctaaagtggctgaagtacccaaaaagcctgttgtcgaagaaaaagaaccaattcctgtg
cttaaaaagccggtacttaaaaaaccagagccgccgcctcctcctgctaaagagccaaaa
ctagaagctaaagaagtggttcattatgaagaacgagaggtgcgaacagtcactggagtc
agagaactaaaacaagtgtctgtttaccaagacatagaagccataactgcacttgaagaa
cctgaacaggtttcagcttatgaaataacaccgcctgaagaatacatcgctgaggcgcga
gaggccattgttttgtatgaagaagaggaaaccgttgctattcctgaagaaccagaggtt
gtcactgctcctgaggaaccttcacctcccactgtgcccaaacccaagcctgttcctgtc
cgtaaaaaagcagaacctgcagctccgcccaaaaaaccagaaccggcaccagtgcctaaa
aagtccaaacttgctcctgtgccgaaaaaaccagaacctccagtggtgctgaagaaacca
gagcctttatttaaaaaaccagaacgtccccctgttgaagaactggatcgtgaagaggag
cgagaggtagagacttttattgggtacagagaacggaaacacgtttctgttcaccaagaa
ctccaggccataagtgccttcgaagaacctgaacaggtttccacttatgagataacagag
ctagaggaatacatggcggaggaacgggaggccctgatttcctacgaggagccagaacct
gtcgcggttcctgaagaaccagaggtcacagctgttcctgaagaacctgcacctcctatt
gtgccgaaaaaacccaagcctgtggctgtacctaaaaaagcagaacctgcccctgtgccg
aaaaagccagaacctgctgtggtgccgaaaaaaccacaacctgcagctccacccaaaaag
cccgagccagcgccagtacctgaaaagcccaaactcgttcctgtgctgaaaaaaccagaa
gctaagaaaccagaacctgcgtttaaaaaaccagaagctccagcagttgaagctttggtt
cacgaagaggaacgagaggtacagacttttattgggtacagagaacggaaacacatttct
gttcaccaagacctcgaggccatcgctgcccttgaaccggaacgggcttcagctttcgaa
gagccggagccagaggaatatgttgctgaggtacgagaggccctgattgcctacgaagaa
ccagaacctccttctgctcccgaagaaccgaaagtggctgccccagtagaacctaaaaaa
cctgaacggccgcctgcaaaagtgcccgaggtacccaagaaagatgttccagaaaagaaa
gtaccagctcctgtgcttaaaaaaattaaaccaccgcctccaaaagtgcccgaagagccc
aagaaaattgttcctgagaagaaaatacctgcggttgcccttaaaaaaccagagcctcca
cctgccaaagtgcctgaagcacctaagaaagctgtgccagaagaaaaagtacctgcggtt
gtgcctaaagagccagaacccctgccccctacagagcccgaagttactgaggaaattgaa
ccggaagaactaatacctgctcctgttccagaaaaagaagaaataattcccacagaagaa
gagccagaaccagaaaagaagatacctgaaaaacctaaaccccgtgtacctttcccacca
aaagaggaagttaaggaggaaaaggttccatttaaagtacctggactgaaaccacggaaa
cagcttcctccaccacctccgacaccaaaggaagaagttgttttgaaaaaagttccaaga
gccgttaagaagcctgaggaggaagaagccaaacccgagaaagacttaaaagttgaaccc
aagcctgttattgaaaagatcaagaagcctgaagtgccagagattccgaagaagaaaact
gagatcttgcctttaaagaaaagggaggagaaagagaaacctgttcctgaaccagccaaa
gttccagaacctaaaccagcaacacttcctgaaccaaaacctgttacagccctaaaatct
cctaagcctgctgcagaaccaaaacctgaagctgctcctgtgacggctccagtggttgga
aagaaagcagagcccaaagctacacccgaaaaagaacctgccaagggtagaagtccaatc
aaagccaaaaagacaccttcgcccgccgatgcagagagaaggaaattaagaccaggaagt
ggtggggacaagcctcccgaggagccccctttcacctaccaactgaaagcagtgcccctc
aagtttgtgaaagaaattaaagacgtagtgatgactgaagcagagtctgtaggctcttct
gccatctttgagtgcctcatctccccctccacggccattacaacatggatgaaagatggc
agcaacatccgcgagagccctaaatacaggttcctctcggatgggaaagacaggaagctc
cacattattgacgtccagctctcggatgccggggaatacacttgtgtactgaaactggga
aacaaagaaaagacctccacagccaaactcgttgttgaagaattaccagtgcgctttgtg
aagaccctagaagaagaaattactgtcgtcaaagggcaaccctgttatctaagctgtgag
ctgaacaaagagagagatgtggtctggagaaaagacgggaaaattatcaaagacaaacct
gggaaatatgctattggtatcatcggtctgcagcatgcagtcactatcatggatgctgat
gacactgacggtggagaatactctgtaactgtcgacattgctaacatcagctgcaaaaca
actgttaaagttgttgaggtcataaaagactggctagtaaagcctatcagagaccagcat
gtgaaaccaaagggtactgctacctttacttgtgacgttgttaaggatactccaaatatc
aaatggtacaaaggcgacgaagagattcctatggagccaaatgacaaaacagaaatatta
aaagatggacatcacctctacctcaaaattaagaatgcgaccccagatgacgagggagaa
tattcagtggaagttgaaggccgtagatatccagctaaactgacacttggggaacgtgag
gttgagctgcttaagcctcttgaagatgttactgtttatgagaaagaaactgcaaccttt
gatgccgagatttctgaacacgatatccccggggaatggaaactaaaaggcgaaatactc
cgaccttccccgacctgtgaaatcaaatcagacggtggaaaacgcttcttgaccttacac
aaagtcaaattagaccaggctggagaggttctctaccaggcattgaatgcagttacttca
gctatcctgacagtgaaagaaattgagcttgacttcgctgtgcctctgaaagatgtaact
gttccagagaagcgacaagcaaggttcgaatgtgtcctcaccagggaagccaacgtcatg
tggtcaaaaggcactgacatcatcaaagttggagagaaatttgacataattgccgatgga
aagaaacatatcctggtcattaatgattctcagtttgacgatgaaggagagtacaccgct
gaagttgaagggaagaaaaccacagccaggctctttgtagaaggtgtcaggctgaaattc
atctcccccctcaaagaccagacagtgaaggaaggagaaacagcacactttgaattcgaa
ctttcccatgaaggtatgccagtgacctggtataaaaatgacaagaagctccatacaagg
agaactgttcacatcaccgcagaagggaagaaacacaaactagagatacaagaagtgaca
ctggatgacatctctgaaatcaaggctgtagtcaaaaacctgcacacacaggcacatctg
aaggtgttagaggcagacccctatttcactgtgaaattgcaagactatactgctaccgag
aaagatgatgtcgttctggagtgtgaacttagcaaagatgtgccagtgaagtggtataag
gacggtgaggaacttaccgcttccaagaaaatttccataaagactgacggcaaacgccgc
atattaaaaattaaaaaggtgtccgatgctgacaagggaaattatgaatgtaactgtgga
actgacaagacaaattctgaatttaaggttgaggctcgactaataaaaatagagcgtcct
ctgtatggagtggaagtatttgttggtgagacggctcgatttgaggttgaggtttctgag
cctgatgtccatgcaatttggaagctaaagggagaaactttaacaccttcacctgaatgt
gaaattattgaagacggcaagaagcacatcctggtcctttacaattgcaaattggatatg
acaggagaagtgtccttccaggctgccaatgctaaaagcgcagctaatctgaaagtgaaa
gaactgcctctcatctttataacgccgctcagtgatgtcaaagtctttgagaaggatgaa
gctaagtttgagtgtgaggtgtcaagggaacccaagagcttccgttggttgaaaggaacc
caggagctcaaaggagatgaaaggtttgaaatcataccagaaggcacaaagcatgccctg
gttattaagactgtggcttttgaagatgaagctaaatatatgtttgaggcggaagacaaa
cgaacaacggcaaagctgatcattgaaggcattcggctgaaattcattacgcctctcaag
gatgttacagcaaaagaacgcgagactgcagaattcactgtagagttgtcccacgataat
atccctgtcatctggtataagaacgaccagcggctccataccagcaagtttgtttcaatg
aaagacgatggcaaattccatacgctgacatttaaagatctcaatattgacgatacatct
caaatcagagtggaagccatgggcaaatcatgtgaagcaaaacttaccgtccttgaaggg
gatccgtattttacggggaagcttcaagattacaccgctgtggagaaagatgaagttgtt
ttacaatgtgaaattagtaaagcaaatgctccggtaaaatggtttaaagatgggaaagaa
ctgactccgtctaagaatgttattatcaaggcagatggcaaaaagagaatcctgatcctc
aagaaagccttgaagaaagacattggccaatatacttgtgactgtggcactgaccagacg
tctgccaagctcaatatcgaagagcgcgatattctgattgtgcgtcccctctacagtgtg
gaaatatttgagacagagatggctcgttttgaaacagaaatctccgaggaggatgttcat
ggcaactggaaactgaaaggggagcccttgactcagtcccctgactgtgagattaaagaa
gaaggtaaaaggcactgtgctgtactctacaatgtgcgcttggaccaggctggtcctgta
gacttccaagcggccaatgccaaatcaagtgctcatcttcgagtgaaaccgcgtgtgatt
ggtctgctgagacctctcaaggatgtaactgtgacagctggggaaacagccacctttgaa
tgtgagctctcctatgagggaattgtcgtggaatggttcttgaaaggacagaaactggaa
cccagtgacaaggttgtccctcgtgctgaaggaagagttcatagccttgttctcagagat
gtgaaactcacagatgctggagaagttacgctgactgcaaaggacttcaaaaccaaagca
aatcttttcgtaaaagaaccacctgttgaatttactaaacctcttgaggaccagacagta
gaggaggaggccactgctgtgctcgaatgtgaagtgtccagggaaaatgcacctgtcaag
tggttcaagaatggccaggaaattcacaagaccaagaaatatgacatcattgctgacggc
agagtcagaaaactgatcattcatggctgcacactggatgatgctaaaacctacacttgt
gatgctaaagatttcaagacctcttgcttcttgaatgttgagccaccacatgttgaattt
accaagcctcttactgatcttgaagttagagaaaaggaagtggctcggtttgaatgtgaa
atttctcgaccaacagttaagtcaaagtggtttagggatggcgtggaaatcagaaaaggc
aagaaatacgacatcatcactaaaggtgcccagaggatacttgttatcaacaaatgccta
ctcgatgatgaagcagaatatgcctgtgaagccaaaactgcccgaacctccggcatgctt
actgtgatagaagaggaagctgtgtttaccaaaaatcttccgaatattgaggccaatgaa
acagacacggtcaaattgatctgtgaggtgtcaaagccgggtgcagacgtaacctggttc
aaaggggacgaggagctgcctgatggcgggcgatacgaacagattgctgaaggccggaag
aggatattggtcatccacaatgctcgccttgatgacgcaggggcctacagctgcaagctc
ccaagcactaagacaactggcaagctgaaagtgaatgaactcgctgcagaatttatcacc
agaccccagaacattgaagtacttgaaggagaaagggcggaatttgtctgctcagtatcc
aaagaagcttttgaagtccagtggctaaaggctgatactgttcttgaagcaggtgataag
tatgacatcatttctgatggcaaaaagcggatcctggttgttaaggagtcagtccttgat
gacgagggaacttacgctgtcatggttggtgacgccaaagcaaaagcacgattgagagta
attgaaaaactccggattgttattccactgaaggaccaagaagctaaagagggacaagag
cttgtctttaattgtgaagtgaataccgaaggtgccaaggctaagtggtacaaaaacgaa
gagccaatatttgatagtgcaaaatacatcattgtccataaggacctcatttatactcta
agaatccgagatgcccagatgaatgaccaagcaacctacactgcagcgcttacaaaccaa
agaggagaacacgtcaagacttcagcggctttaactgtgcttgaggaggatctcagaatc
gttgagcctcttgaggacatcgaaacgatggagaagaaatctgttacattctggtgcaaa
gttaaccgtctcaacgtaaccctccattggacaaagaacggcgaagaaatcacctttgac
cgccgtgttttgtacaaagtggataaatacaagcactcactgatcattaaaaactgtgga
ttcgtggatgaaggggaatacacagtcaccgctggacaagacaaatccgtggcggagctt
attatcacggaggcacctactgatttcattgagcacttgcaggaccagactgtcactgaa
tttgacgatgctgtctttacttgccagctctccaaagagaaagcaagtgtgaaatggtac
agaaatggaagagaaatcaaagagggcaaaaagtaccaatttgaaaaggatggaaatttg
caccgattaattataaaagagtgcagaccagaggatgaatgcgagtattcctgtggagtg
gatgacaggagatccagagcaagactttttgttgaggaaattcctgtggaaatcatccgg
ccaccacaagatatttatgaagctccgggctctgatgtcatcttctatgcagaattgaat
aaagataaggtggaggtcaaatggctgagaaataatatgattatagtccagggagataaa
catcaaatgatgagtgaaggaaaggtccataggctacaagtctgtgacataaagccacgt
gaccaaggagaatatcggtttattgccaaagacaaagaagctcgagctaaactagaattg
gcagctgctccacgaataaaggcggctgatcagaaccttgtggtagatgtcggccaaccg
ttgaccatgattgttccatatgatgcctatccacgagccgaagcagaatggtttaaagaa
gatgaagccttgccgactctgacagtggatacaacagctgagagcagtaccttcagaatt
tatgaagcaaagccatcacacagaggaaattacaaagtcatacttaaaaataaacatggc
caagctgaagcacgcatccatgttcaagttattgatgtccctggaccggttagaaacctg
gaagtcactgaaacatttgatggtgaagtgagcctcgcctgggaagaaccagaaagtgat
ggtggtagtaaaatcactggttatgttgttgaaaggcgtgacatcaagcggaagacctgg
attttggcaactgatcgtgccgacagttgtgaatacacagtgactggcctgcaaaggggt
ggagttgagtacctcttccgtgtcagtgcgaaaaacagagtggggactggagagcccgtg
gaaacagacaaacctgttgaggcaaagagccgatttgaggttccaggtcctcctctcaat
gtacaagttgttgatgtgaacagatctggcgcaactctgacttgggagccaccagaatac
gacggaggcactccgattacgggctatgttgttgaattgcgtgacagagcttccatcaaa
tgggagccagccatgaccacagggccagacgatttatctgcaacattgacggatgtggtg
gaaaacaaagaatactttttcagaatcagggctcagaaccaggttggagttggcaagcct
agtgcttctacccatgcggtgaagattatggatccaatcaaaaagccaagtcctcccatt
aatcttgatcattctgaccaaacgaagacatctgtgaaacttacatgggaacctcctctg
aaagatggaggcagtccagttttgggctatatcatcgagagacgtgaggagggaacagac
aactgggtccgctgtaacccaaagcttgtgcctagtctcaattacaaggtcactggactg
acaccgctagccaagtattattacagagtatctgcagaaaatgctgctggagtatcagac
ccggctgaagcgattggaccactgactgcggatgatactcatgttggacctacaatggac
ttaagtggatttaaagatggacttgaagttatcgtcccagaaccactaaaaatacgtgtt
cctatcactggttatccagtaccaactgccacgtggtcagtgggtgacaaagtattagaa
caaggtggtcgggtgaaaattgaaacttcaattgcctttgcacagcttattattactccc
agtgaacgaccagataaaggcatctataccttgaaattagaaaatcctgtgtcctctgta
tcgggagaaattgatgtcaacgtcattgctcgcccaagtgcaccaagagaattaaaggtt
ggcgacataactaggaactcagtacagctaacatgggagccacctgaaaacgatggagga
agcccactgactggctacgttgttgagaaacgggaagtcagccgcaaaacctggatcaaa
gttatcgacaatgtccttgaccaagagttcatcgtacctgatcttgcccaagggaaagaa
tatttgttcagggtttgtgcttgcaacaaatgtggagcaggggaaccagcatatattgat
gaacctgtcaacatgtcagcacctgcaactgtgcctgatccaccagagaatgttaaatgg
agggacccaacatccaaatccattttcctgacatgggaaccccccaaatatgatggcggc
tcacgtatcaaaggttatattgttgaaaaatgccagcgtggcactgacaaatgggagcct
tgcggtgacccgatcattgagaccaaaatggaagtaacgaaacttaaggaaggagaatgg
tatgcataccgtgtgaaggctctgaacaggatgggagcgagtaaaccgagcaagccaacg
gacgatattcaggcagtggacgcaatggaggccccagagattttcctagacgtgaaacta
ctggctggaatcacggtcaaagccggaacgaaaattgaactgccagcaagagtaactgga
aagcctgagcctcggattacctggacgaaagcggaccatgtcctgagacctgataaaaga
atatccattgagaccaagcctaaccagtccatagtcacaataacagacagcaagagagac
gacagtggcacctatattattgaagctgtaaataccagtggccgggcaactgcagttgtt
gaagttaatgttctagataagcctggtccaccagctgcgtttgatgtgtctgacattaca
aatgtgtcttgtttattgacctggaatcctccgcgagatgacggcggctccagaatcaca
aactatgtcctagaacaacgagctgcagacagcgaaatatggcacaagctgtcatccacc
atcaaagagacaaacttcaaagtgacaaacctaacgcctcataaagaatacatcttcaga
gttagtgcagaaaacatgtatggagttggagaaccagtccagtctgagcctatgatcgct
aagtatccctttgatacgccaggccctccaacacaagttcaaccagttgagatcactaaa
gattctgtaacattaacgtgggctgaaccagatgacgatgggggcagccctatcactggt
tactgggttgagcggttagaccctagccaagacaaatgggtccgatgccataaaataccc
gttaaggatacaacattcaaggtgaaaggtcttatgaaccataagaagtacaagttccgt
gtcttggcagagaatcttgctggaccaggaaaaccaagcaaagcaacagagccaatctta
gtgaaggatcctattgatccaccatggcctcctggaaaaccaacggtgaaagatgttggc
aagacctcgtgtttcctgcagtggacaaagccggaacatgatggtggggccaaaattgag
tcgtacgtcattgagttgttgaagactgggacagatgagtgggtgagagtggctgatggc
attcccaccccagaacacttcctcaaggggctcatggagaaacaagagtactcattccgt
gtcagagctgtgaacaaagctggagaaagtgagcctagtgaacccagcgatcccgtcttg
tgcaaggagagactgaatcccccttcaccgcctcgatggcttgaggtcattaatattact
aagaacacagcggaccttaaatggacggtaccagaacgcgatgggggctctcccattaca
aattacattgttgaaaagagagatgtgcgacggaaaggctggcagactgtcgacaccacc
gtgaaggacacaaaatacaccgtgactcccttaacggaaggctccctgtatgtgttccgt
gtggctgccgagaatgcagtgggacagagtgactactgtgaaattgaggattctgtactt
gctaaagataccttcactactcctggagccccatatgcactgacaccggttgaagtgaca
aagagacatgtggacttgaaatggcaaccgccaaagaatgatggtggcagacccattctg
cgctatgtcattgaaaagaaagagaagcttggcacacgctgggtgaaggctggcaagacg
gccggccctgactgtaacttcagagtaaccgacgtcattgaaggcactgaagtgcagttc
caggttcgtgctgaaaatgaagctggctgcggtcatcctagcgaacccacggatatcctg
ccaattgaagacccaacaagtcctccttcacctcctctggatttgcatgtgacagatgca
agcaggaaacacatttcaattgcctggaaaccacccgagaaaaatggtggaagtcctata
attgggtacaatattgaactgtgcgaagcaggaactgagaaatggatgagaataaattcc
cggccgatcaaagacttgaaatataaagcagaagaaggcattgtgcctgacaaggagtat
gttcttcgggtcagagccgtcaacgctataggagccagcgagccatcagacatatcggaa
aatgttgtcgccaaagatccagattgcaatccaactgttgatatcaagacgaaagacctt
gttgtcgttgaaggggaaaagttaagcatccctgttccgtttagagctgtcccatctcca
accattgcctggcataaaaatgggaaagagcttaaagcaggcgagcgaacaaccataaaa
agtgactacagctctgctttggtggaagtaacgaacgtagtccatgctgatgctggcgtt
tacacaattaccttggagaacaggctaggttccacaactggcacggtcaatgtcaaagta
ataggtctgcctgggcaatgccaaagtattaaggcaagtgaagtgactaaaaattcatgc
aaagtgacttgggagccaccagagtttgatggcaatactcccatattgcattacgttctg
gaacgaagggaagctggtcggagaacatacataccagtcatgtctggtgagaacaaactg
gcatggcaagtaaaagatcttataccgaatggcgaatactacttccgtgttaaagctgtc
aataaaattggaggaggtgaatatcttgaactaagaaatccggtcattgcagaggatcca
aagcaacgcccagatccgcctgttgatcttgaggttcataatccaacagcaaagtcagta
accctcacatggaagccacccttgtatgatggaggaaccaaaattttgggctacgtgctg
gaaaaactacctaagggaggagaaaagtgggaacggtgcaatgactttttggttcctctt
ttgacttacaccataaaagatctcgaagaaggccaacaataccagttccgtgtccgtgca
gagaatgctgcaggcgtcagtgaaccttctaatatcacacctatgacaaaagcaatggat
cccattgaggctccaaaggtcttccttgctgctagtcttcgggatggtcttgaggtgagg
caaggttctgagatccaacttgaagcacacatttcaggatcgccttacccagctatagct
tggatctggaacgatgacgttattaaaccgacagaaattaaaaagagagttaccaagatt
actaggaggaagaaaggagaagttgaagaagacgaacctttctacttatctctgcctgag
cgattgaacatcgacaatagcaaacgaggaacatcattgctggctgttcgggactcaatc
agaaaagatcacgggacctatactatccgggttgagaatgatcatggggttgcaaaagct
acatgcgaagttaatgtgttagatctccccggaccaccagtcaactttgtctttgaagat
gttcggaaaaactccattacttgcaagtgggagcctcctcttgatgatggtggaagcgat
atattgaactataccttggaaaagaaagacaacacgaaagctgagattggctgggtgact
gtcacttcaacgcttaggcacctcaaatataacgttgtgaaactgattgagggaaaagaa
tacatcttccgtgtgaaagctgagaacagagttggggcagggcctccatgtgtttcaaaa
cccgttgtagctaaagatccatttggtccccctgatgcacccgataagcctctcgtagaa
gaaccatccagcagcagcatgttggttaaatggaatgaacctaaagacaatggcagcccg
attttgggctactgggtcgagaaacgtgaaataaatggaactcactgggctcgagtgaac
agagagcttgtgaacgccctggagatgagagtggaagggctgctagaaggactgacctat
gttttcagagtttgtgctgaaaacgcagctggccctggcaaattcagtcctccgtcagat
cccaaaattgcacaagatccaataatgccgcctggtccacctgtccccagaatagttgac
acaagctccacagctatcgacctcgaatgggatgctccactatacaacggaggaggagac
atcacaggctactttatttacaagcagtttatgggctccaatgagtggtcgcgttgcaat
gataaagccattaaggttcgaagctatatcgtgaaaggaatcagggaaggggctgattac
aaaatccgtgttactgcggtcaatattgctggagaagggcctcctggagaaacagagcct
ataacagttgcagagccccaagagcctcccacggttgagctggatgtttctgtcagagca
ggtgttcagatattggcaggccaaacccttagacttcctgcagttgttactggacgccct
atacctacagttgtgtggacgttagaggatggggaaatcgataaggagcgggtggagatt
gaaaacgttggcacttcatctgtgttgactatcaagaatgcactgaggaaagatcatgga
agatacatgattactgcaacgaatgacagtggttctaaatttgctgccaccagggtagaa
atctttgatgttcctggaccagttactgatctacatcctgtagtggtgaataggaagatg
tgtcttcttaactgggatgatcccaaagatgatggaggaagtgacctcactggtttcatt
gtagaaaggaaagatgccaaaatgcatacttggagattagctgtagacacagagagatct
aaatgtgatattactggtctcgttgaagggcaggaatataaattccgtgtatccgccaag
aacaagtttggctgcggtccacctgttgaactgggaccaatccttgctgttgaccccaaa
ggtcccccaactgcaccagaaaggttcatgtacacagagagaacaaaatcctctgttaca
cttgactggaagcctcctcggaatgacggtggcagccccatcattggctacatcgtcgac
aagagaagacacgactcaaacgagtatgaaagagtcaataagagactgtgtccaactacg
tctctcgttgtcgataatcttgctgaactgcatatgtatgaattccgagtcaaggccgtc
aatgagattggggaaagtgaaccatccctgcctctaaatgtagttgtacaagatgatgaa
gaacctcccacagtgacattacatctgacggtgaggggagacactatcaaagtcatggca
gggcagccggtcaacatgcccgccgatgtgacaggtcttccaatgccaaagattgaatgg
tccaaagatgaggttgttattgacaaatcaacagatgcccgtaagatcaccaaaaaggaa
gtatcaaggacggaagcaaaaaccgaactcagcatgccagcagtaacaagggcagacaaa
ggcacttatacagttacagcttccaatcgacttggcacggcatatcgcaacgttcatgtg
gaagtcttcgatcgtccgtctcctccaaggaacctcaccgtatcggatattaaagccgaa
tcttgctgtttgacttgggacgccccccttgataatgggggcagtgagatcactcattat
atcattgacaaacgtgatgccagcaaaaagaagagcgaatgggaagaagtatccagcact
gtggtggacagacgatacggggtctataaacttacaacagatggtcaataccaatttaga
attagagcggtcaacagatttggaacaagcgatgaatgcctttcagagaaagtggttatc
aaggatccttatggtcttcctggaccccctgggaaaccgaaggttatagaccacactaga
tcatcaatgctggtaacatggaaaccacctctagacaatggtggagccccaattactggc
tattggctagagaagaaagaagaaggaggtgtctattggtctcgcgtcaacagagctccc
gttacaaaaccagcagtgaaagggttggaattcaatgtattgcgtttgattgaaggtgta
aaataccagttcagagcgatggctataaatattgctggaattggtcctcccagtgaacca
tctgatctttacgaagctgcagacccagtctttcctcctggtgcaccatcatgcccagat
gtcaaagacaggaccaagtcaacaatctctcttgcctggaaacctccacaaaaagatggt
ggcagtcctattaaaggatatattgttgaaatgcaagaagaagggagttcagattggaag
aacgtgaatgaaccagacaagctgttccctacctgtgaatgtgttgtgcccaacctgaaa
gagctcaggaagtatagattcagagtaaaagctgtgaatgctgcaggagaatctgaacca
agccttgcaacttctgaaatagaatgcaaggatatactagaggagccagaagtatatatt
gatgttggagcccaagacttcctctcttgccgaactggcactacaatcaaaattccagca
gttattaagggacgtccaattcctaaaacatcctgggaatttgaaggagaagcaaagaaa
gtattaaaggatgtgcatactatacctgaagatgccacggtggattcaactgataccact
tcagtaattactatcccagaatgcaacagaggccattcaggaaaatacagtattacagct
aagaacaaagcagggcaaaaaactgtaaacgtcagagtgaatgtcctggatgtaccaggg
ccaccaaaagacctaaaagtcagtgatataacaagatgcagctgtaaactttcctggaaa
atgccggacaatgatggtggagacagaatcagaaactatattattgagaaaagaacagtt
gaaggcaaggcctggaccaaagtgaatccaaactgtgccggcacgtccttaatcatccct
gatctaattgccgggcagcagtatttcttccgtgtacgggcagaaaatcgctttggcatt
ggacccccagcagatacaattcagaggaccaccgcaagggatccaatccatcctcctgat
ccacctatcaaactcaagattggccttataactaaaaacacagtaaacctgtcatggaag
cctcccaagaatgacggcggtgctcctgtgacgcattacaatattgaatgcctccgctgg
gatcgtacaggcgaaggaaaggaagcctggagacagtgcaacaggcgtgatgtggaagaa
accatgttcaccgttgaagacctcaaagaaggcgatgagtatgaattcagagtgaaagcc
gtaaatgaagctggtccaagcagaccatcagctacagtggggcctgtcgttgtcaaagat
cagacgtgccctccagcgatcacactccgagagtttatggaagtagaagaaggaacagac
attaacattgtagccaaaataaagggtgtgcctttccctaccttaacctgggttagagcc
cctgtgaagaaacctgatgacaagttgccagtgatctatgaccagcatgtcaacaagatt
gtgggcgaagactcttgcaccttactgatacagcagtcccgcagaaaggataccggcctg
tacactataacagctgtcaataaatttggaactgattcaaaggagatgagattgaatgtt
cttggtcggccgggaccaccagaaggacccattaaatttgaggctatttcagctgatcac
atgacaatatcttggcttcctcccaaagatgatggtggctccaagataactaactatgtc
attgagaaacgggaagccaacagaaggacctgggtccctgtcaccaatgagcctaaggaa
tgcatctatacaataccgaaactgctggaaggccatgaatacgtcttccgcatcatggca
cagaataaatatggcattggggaacctctcgacagtgaacctgaaactgcaagaaatctt
ttcaccgtccctggaatttgtgacaagccaacagttagcagcatcacacatgactcgatg
acagtcaactgggaggaaccagaatatgacggaggctcccctgtgacaggctattggcta
gagcgtaaagaaactactggaaaaaggtggacaagagttaaccgagatcctatcaagcct
atgacactgggcgtttcttacaaagtaacaggccttattgaaggttcagattatcagttc
cgtgtgtacgctattaatgcagctggcgttggcccaccaagcctgccatctgatccagca
actgcaagagacccaattgctccacctggtcctcctattccaaaagtaactgactggaca
aaatcctcagttgaccttgagtgggctccgccgttaaaagatggcggttctagaatcact
ggctacctagttgaatataaagaggaaggaaaagaagaatgggaaaaggcaaaggataaa
gaaataagaggaaccaagtttgttgtcgcaggattaaaagaaggaggtttctatagattt
agagtcagggcaataaatgctgctggtattggagaacctggagatgttacggaagtcatt
gaaataaaagacagaatagttgctcctgaccttagtttggatgctcatgtgaaagacaga
attgttgttcatgccggcggggtgatccgcattatagcatatgtctcaggaaagccgcct
cctaccattacctggacgaaggacgaacgagctctcccaggagaggctaacattgaggaa
acggctattagttcctctatggtcatcaagaattgcaagagaagccatcaaggcatctac
accctgcttgctaaaaatgcaggtggagaaagaaagaaggctgttatcgttgatgtgcta
gacgtaccaggtcccgttggcattccattcctgactgaaaacttgacctcggactcttgc
aaacttacctggttctctcctgaagacgacggtggctcagctattactaactatatcatt
gagaagcgtgaagcagaccacagggcttggacaccagtatcgtacacagtcaccagacag
aacgctaccgttcagggactgatcgaaggcaaagcatacttcttccgaatcgcagccgag
aatatcattggcatgggtccatttgtggagacgacaaaagaacttctcatccgagaccct
ataactgtaccagagaggccggaagatcttgaagtaaaagcagtaacaaaggattcggtc
tcactgacttggaacccaccgaagtataatggtggctctgatataaccatgtatgttttg
gaaagccgtctcattggaaaagagaagttttctagagttacaaaagagaaaatgctggac
aggaaatacacagtggaaggactgaaagaaggtgacacctatgagtaccgtgtgagtgcc
tgtaatattgtgggacaaggcaaaccatcattttgcacaaaacccatcacatgcaaagat
gaaattgctcctccacaacttgaacttgacatcagagataagctcactgtccgtgtagga
gaagctttcagtctcactggccgttattcaggcaaaccagcaccaaaggttacttggtac
aaagatgacattacagtgaaagaagacaaacggaccaaaatccaaacgactccagcaact
ctttgcttagggatattaaaatctacccgggaagattccggcaaatactccgttgttgta
gaaaacagctcagggtcaagaaaaggcttctgtcaagtgactgtagttgaccgtcccaca
cctccagtcggcccagttatttttgatgaagtgcataaggatcattttgttatcacctgg
aagcctcctttggatgatggcggcagcccaattactaattacattattgagaagagagat
gccaaccgggacatctggatgccagtcacatcagcctgtgtcaaaacaacatgcaaagtc
cctaagttgcttgaaggaagagactatgttgtccgaatttatgctgaaaatttgtatggc
atgagcgatcccctggaatctgatgaaatgaaggccaaggatcgtttcagtgtccctgat
gcaccagatcaacccatcatcaagaacgtgaccaaaaattctgccttggttacctggaac
aggccacgtgatggaggaaaaccaataactaattatatacttgaaaggaaggaaaccatg
tctaaccgatggacaagagtcaccagagatcctatttacccagacactcagttcagggtg
acagatctccttgaaggctgcgaatatgaattcagagtttcagcagaaaatgaaatcggt
gttggtgaacctagcccgccgtcgaagccattctttgctaaagacccaattgttaaacca
agcccaccaattaatcctgaagcagtggataaaactaagaattcggtcgttttgtcctgg
caaccgccacgccatgatggaggagggaagattataggctatttaatcgaataccaaaag
gttggagatgaagagtggaaaaaagctaaccatacagctgatgcttgtcccgagacaaaa
tatgaggtcattggcctcaccgaaggtgccaagtataaattcagagtcatggcggtgaat
gcagcaggagaatcagagccggcttacgttcgtgatcccgtggaagtcaaggacagactt
gaggctcctgaactaatcctggatgctaacatggctcgggaacaacatgttaaagctgga
gatacgctgaggctcagtgcggtaattaaaggaatcccattcccaaaagtgtcttggaag
aaagaagacaaggaagtttctacaaaggcagatattgaagttacaaaagttggcagtaag
ctagaaattcgtaatgctgcccatgaagatggagggatttattccctcactgtggaaaat
ccagctggatcaaagacggtttccgtgaaagttcttgtgttagataagcctgggcctcct
agagacctgcatgtcagtgaagtccgaaaagattcttgctacctgacttggaaggaacct
gaggacaatggtggctctgtcattaccaactatattgtggaaaggaaagatgtagctgct
cctcagtggctgccaatatcttcctcctccaagaagcacagcttgctggcgaaatacctc
atggaaggcactcagtatctcttccgtgttgctgctgagaaccaatacggacgaggtcca
tttgtggaaaccctcaagccaattaaggctgtagatccacttcatccgccaggcccacca
aagaacttgcatcatatagatgttgacaagacagaagtctctcttgtttggaactggcct
gatcgtgatggtggtgctgaaataactggattcctggtggagtaccaagaagaaggcgca
aaggactggactaaattcaaaaccgtccctgtgccagagtgtgttgttactggcctacaa
caaggaaagatctacaaattccgtgtgaaggctcaaaatatcgttggtcttagtcttcct
gacacaactataccaattgagtgccaagaaaaattggtgcctccatctgttgacctggat
gttaaattaatagagggccttgttgttaaagccggaaccacagtaagattccctgcaatc
atgagaggtgtccctattcccactgcaaaatgggttacggataatactgaaattaaatca
gaaggcaattacaagatcgatactgataattactcaacagttctcactattaaaagctgc
acaagaaaagacactggggagtatttgctcacagtatctaacgcagctggaagcaaaacc
gtacctgttcatctaacagttttggatgtacctggtcctccaaccggtccaattgatatt
ctagaagtaaccccagatcacatggtcatttcctggcgacctcctaaagatgacggtgga
agtcctgtgattaattacatcattgagaagagagaatcaaatagggaaacatggggagtg
gtcagttcaggaatcaatcaaactagaattaagattccacgtctacacaagggccatgaa
tacatattccgagtctgtgcagagaataaaataggcattggtgcacctcttgattcacaa
ccagcagttgctaaagctatgtttgacccaccatctccaccgggtaaaccagtagtacat
gatattttagaaaatgccgcaacggtaacgtggtctatacctaaatctgatggcggaacc
ccaatcattggatacattcttgaacgccgtgaaatctctggcaagtgggttcgtgtcaac
aaatcgccagtgcttgatctcaggttcagaactacaggactgtttgaaggcaacacatat
gaattccgtgtttttgcagaaaatagtgttggcataagccaaccgtctccggtttctgac
ccaataaaagcagcacgtcctatcaaacctccgggaccacccattaatccaaaactcaag
gataaaaccagagaaacagctgaactagtatggacaaagccactcaaagatggtggtagc
cctattctgggatatgttgtagagtgccagaagagcggaactacacagtggaatagaatc
aataaagatgaacttatcagacaatgtgcctttactgtacctggactcattgaaggaaat
gaatatagattccgtataaaagctgctaacattgtaggagaaggagagcccagggaattg
ccagaaacagttcttgccaaagacatccttagccctccagaactagagctggatttgacc
tgccgtgatgtcattactgtcagagtaggccagacaataaagattactggtaaagtgaaa
ggtagaccctatcctgacataacatggtctaaagatggtaaaacactaacaaaagatcaa
cgtgtggaaataattcaggaatatcctcatattgagctgcaagtgaaaaaagctgtaaga
gcagaccacggcaaataccttatttcagctaagaatagcagcgggcacgcacaagcatca
gccgttgttaatgtccttgaccggcctggcccttgccgaaacctgaaagtgagctacgtc
acgaaagattcttgtatggtttcttgggacaaccctgaagataacggtggctctgaaatt
acaaattacattgtggagtgtcgtcatccgaatcagagaggctggtcaatagtttccgct
gatcttactaaacgtttggtaaaagcacatcttatagagaaccaggagtatttcttccgt
gtttgtgcagaaaacaaagtaggcccaggacccattgtcgagaccaaaactcccatcctt
gccatcaatccgattgatcgaccaggagaaccggaaaacctacatattgccgagacagga
aagacatttgtgtatctaaaatggaggaggccagactatgatggtggcagccccaattta
acctaccatgttgaaaggaagctgaaggattcagatgagtgggaaagggtacacaaaggc
agcattaaggaaacacactatatggttgacaagtgcgttgaaaataaaatttatcagttc
agagttcagactaagaatgaaggcggtgagagtgactgggtgaaaacaagtgaagttgtg
gttaaggaagaagtgcagaagccagtacttgatctgaaattgtctggagtactgactgtg
aaagctggcgaaccgatcagaattgaagcaggactcagaggcaagccacaaccagaagta
tcttgggcaaaggataatgcagatctatccaaatctccaagggtcaaaatagaaaccacg
tcaaacttctccaagatccttctgacaaaagcgaggcggactgatggtggtaaatacgtt
attactgctactaatcctgccggcagctttgtagcttatgctactgtaaatgttttggac
aaaccaggacctgtaagaaatttgaaagtctatgatatttcaattgaccggtgtaccgtc
agctgggacccacctgaggatgatggtggttgtgaaatccagaactacattgtggagaag
tgtgaaagtaaacgtatggtctggaccacatattcttcctcagtgatcatgaactctgta
catgtaacacgtctcatagaaggcaatgaatatatattcaggattcgtgcagagaataaa
atgggaactggtccaccaacagagactaagccaattattgcgaaaaccaagtataataga
cctggtcctcctgatcctccagaagttacaagagtcagcaaagaagagatgactgtggtt
tggaatccaccagaatatgatggcggaaaatcaattacaggatatatattagaaaggaaa
gagaaacggtcactaaaatgggttcctgttaccaaaactgcaatccctgagagacgcaag
aaagtccaaaatcttattccaggacatgagtatcagttccgtgtcagggcagaaaatgaa
attggaattggtgaaccaagtcttccatcaagaccagcaatagcaaaagatccaatagaa
ccccctggtcctccaactaaccttaaggttgttgatagcacaaagacctctattactctt
ggatggggaaaacccgtctatgatggtggtgctccaattatcggatatgtggtggaaatg
agaccaaaaactgaaaaagcaggtcctgatgaaggatggaaaagatgcaatgttgctgca
caggttattcatacagaatttactgtgaccagcctggatgagaaagaattgtatgaattc
cgtgtttcagcccaaaaccaagttggcattggccggccggctgatttgaaggaagctgtt
tctcccaaagaaatacttgaacctcctgagattgaattggatgcaagcttgagaaagtta
gttacagtcagggcaggatgtcccataagactttttgccattgtaagaggacgaccagca
cctaaagttacctggagaaaagtgggaattgacaatgtgatcagaaaaggacaagttgac
ctggtcgacacgatggccttctgtgtcattcctgattctacacgggatgactcgggcaaa
tactccttgacacttgttaaccctgctggagaaaaagctgtttttgtaaacgtccgtgtc
cttgatacacctggacctgtagccgagttcaaggtctcagaagtgacaaaaatgacctgt
caactttcatggacaccacctgaaaacgatggcggcagtcccgttacccattatatcttg
gaaaaacgtgaggctgacaggaagacctgggcgaaacttgttggggacataaagaaaacg
agtttcaaagttattaatcttgtgcctggtacggagtacttcttcagagtgacggctgtc
aatgaatatggtcctggtgttcccagagacacaccaaagccgatcctggcaacagatcca
ctcagtgaacctgatcccccaaggaaagttgaagtgaccgaaattacaaagaacagtgct
actttaggatggctgccacccctgcgggatggtggttctaaaattgatggctacatcatt
tcataccaggaagaaggtcaagctgcagatcgctggacacaatactctattgtaagagat
cttcacatagttgtggctggtctgaaagaaggaaagacatacaaattcagagtggctgca
agaaacgctgttggagtgagtttaccaagagaaactgaaggcaaatatgaaatcaaagaa
cagctcatgccacctaagattctgatgccagagcaagtcagtataaaagctggactgaaa
ctcagggtggaagcccatatttatgggaaaccaaacccgacctgtaaatggatgaaagga
gaccacgatgtgcatatatccagccgcctcgcagtgcataaaggagacagcatgtcagtt
ctcatcattaaagatgtaaccaggaaagacagcgactattacactctccaggccgaaaac
agcgctggtgtggccactcagaaaatcaaagtggttgtcatggatatccctggcccacca
cagccaccatttgaaatttctgacatagacgcggatgcctgcagtttgtcctggcacatc
cctctggaagatggcggcagcaacatcaccaactatgtggtggagaagtgtgacgtcagt
cgtggtgactggataacggtggtagcttccgtctccaagacaaattgcagaattggaaaa
ttaactcctggacaagaatatatgttccgtgtgcgggctgaaaaccggtttggcatttct
gagccactccaatctgataagatgatagcaaagttcccatttgatgttcctagtgaacca
aagaatgcccgtgttaccaaggtgaacaaggattgcatctttgtggcctgggacaggcca
gacagtgatggaggcagtccaatcactggttatctcattgaacggaaagaaaggaacagt
ttgctgtgggtgaaggccaatgacacccttgtgcgatccacagagtatccctgtgcaggc
ttaattgaaggtcttgagtacacattcagaatctatgctctgaataaagccggagctagc
aaacctagcaagcccacagattttgttacagcaagaataccagttgatcctcctggtaaa
cctgaagtaattgatgtcactaagagtactgtgtccctaatctggacaaggcccaaacat
gatggtgggagcaaactgatcggatactttgtcgaagcctgtaagctgcctggagataaa
tgggtacgatgcaatactactccgcatcagatacctcaggaagagtatactgcaactggt
ctggaggaaggtgctcaataccagtttagagcgatagcaaaaacagcagtgaacatcagc
tggccatctgaaccttctgatccaataaccgttcaggccgaaaatgtaccaccaaaaata
gagcttggtgttggtatgaaatccttaattgtagtaaaagctggaagcaatgtttgcctt
gaggctaatgtgtttggcaaacctatgccaactattacgtggacaaaagagaaggaagtt
ctcaaacccgccgaaggaatcaagataaccacaaagagaaacttatctactgtggaactc
ttcagtgtaaacaggaagcagaccggagattataccattactgccgaaaatgcaagtggt
tccaagtcagcaaccgttaagcttaaagtactagacaaacccggccctcctgcttcagtg
aagatcgcaaacatgtatacggaccgggcgatgctctcttgggaaccccctcttgaagac
ggagggtcagacattactaattacattgtcgacaagcgtgaaacaagcaggcccaactgg
gcacaggtcacggccaacgtcccaatcacgagctgtagcgtcgagaaactgattgaagga
cacgagtaccaattccgcatttgtgctgaaaacaaatatggagtaggcgatcccatcctg
actgagccagcagtggctaagaatccatacgatgtccccggaccttgtgatccacctgta
attagtaacataaccaaagatttcatgaccgtcagctggaaagcaccagctgatgatggt
ggctcccctataactggatatattgttgaaaaacgtgaaacaaaggctgttggctggacg
aaagtgaacagaaaaccagtcattgaaagaactatcaaggccactggactccaggaaggt
gcagaatatgagtttagggtgactgcactgaataaagctggaccaggcaaacctagcgca
ccatctaaaggagcatatgctcgtgaccctcagtatcctcctggtcctccagcattccca
aaagttgtcgacacgactcgtagttcgatcagcctctcttggtctaaaccagcatatgat
ggtggaagtcccattatcggctacttggtcgaagtaaagagagctgacaccgacaactgg
gtcagatgcaatttgccgaagaatttgcctgatacccattacgttgtaacaggacttact
gagaacacagaatatcagttccgtatttacgctgtcaataaggttggctacagcgaccca
agtgacgtgccagacaaacaccttgccaaagacattttgattccacctgagggagagctt
gatgctgaattgagaaaagtcctaattttacgtgctggagtcacaatgaggatttatgtg
ccagtgagaggccgcccacctccaaagatttcttggtctaaagtggatgccaacataaga
gataggcaaggcctggatatcaaatcaactgattttgacaccttcctgcgctgtgaaaat
gtaaataaatacgatgctgggaaatatgtgctgcatctggagaacagctgtggcaagaag
tcatacaccattgtagtcaaagtacttgacactcctggaccacctattaacctcattgta
aaggaagcatccaaagattccgcttttatttcatgggaacctccaataattgatgggggg
agtccagtgaagaactatgtggttgagaagcgtgatgcagaaagaaaatcgtgggccacg
gtggccacagaatgtccaaaaaccagtttcaggatttctaacctggaggaaggcaaatct
tacttcttccgagtttttgctgaaaatgaatatggcattggtgacccctgtgaaactcga
gatgcagttaaagcttctgaaacacctgggccggtcatcgacctaaaggctccacatgtc
acaaagtcatcttgcagtttatcatggaaaaagcctataagcgatggtggaagccgcatt
aatgcctaccttgtagagcttatggtaggtgaaaaccagtggcaagaagtgatgaggtcg
aagaatctccagtattcatcaagagatctgaaggaaggaaatgaatacactttcagagtt
agagcacaaaatgaagctgggtacgggacacctagcgaaattaccgtggtggcaagggac
gatattgtggcacctgatcttgatttacgagacctgccaggcttggtctatttagcaaga
gaaggaagcagtttccgtctgaaaatccccattaaaggcaagccagcgccagctgtcacc
tggaaaaaaggagaggatctgacgctgactgagagcggaagagttgcatttgaagctacg
gccattaacacgaccctccttgtacgtgactgtcataaagatgacgctgggaaatacacc
atcaccctgaagaacgttgctggcagtaaagaaggcaccattactatgaaagttgttggc
agacctggaatcccaacaggaccggtgaagtttgatgaagttacagctgacgcgatgaca
ttaaaatggggtcctcccaaagatgatggcggctctgaaatcactaactacatccttgag
aagagagacaatgtgaataataaatgggtgacgtgtgcgtctgctgtccagaaaacaacc
tttagagtgacaagacttcatgaaggctctgaatatactttcagaatcagtgcagaaaat
aaatatggagtaggcgaaggtcttaaatctgaccctgtaattgccagacatccatttgat
gtgcccgatgctccaccaccacccaaaattgttgcagttaggcacgattctgtatctttg
gtatggcaggaccctaaaaagacaggtggttcaccaatcacaggttaccacattgaatat
aaagaaagaaacagtattttgtggaagcgagcaaacaagactccactaaggatgaaagac
ttcagagtgacaggattgacggaaggtctggaatatgaattcagagtgatggcaataaat
ctagctggtgtcggtaaaccaagtcttccatctgaaccagtcgtggccctggatccaatt
gatgctcctgggaagcctgaagttatcagcgtaactagaaactcagtgactctgatctgg
acagaaccaaaatatgatggtggacataaattaattggctacatagtggagaagcgtgat
ctgccatcaaagacatggatgaaggcaaatcatgtgaatgttcaagaatgtgcatttaca
gtgactgaccttttcgaaggttcaaaatatgaattcagaattagagcgaagaatacagct
ggagcaattagtcctccatcagaatcaacaggagccattatatgcaaggatgagtatgag
gcaccaactattgatcttgatcctgctgtcaaagaaggcctgacggttaaagcgggcgat
actattacaatgtctgctattagcatccgtggcaaaccacttccaacttcatcctggtcc
aaagcaggaaaagattttaagccatcagagactgttcatattgaaacaacacccatgtct
tctacactaagcatcaagtatgcagctaggaaagattctggggaatacacaattactgca
gtcaatccttttggtactaaacaggaacatgtacatgtaaaagttttagatgtaccaggt
ccaccaggaccaattgaaatcagcaacgtttcagctgaaaaagcgactctcacatggacc
cctcctatagaagatggtggctcaccaatcaagtcctatgtgcttgaaaagagagaaact
agccgactgctatggactcaggttgctgaagatattcagtcttgtaggcatgttgttact
aagctaattcgaggaaatgagtacatcttccgtgtctcagccgtgaaccaatatggaacc
ggagaaccatcccagtcagaaccagttaaaatggtggatagatttggtcctcctggtcct
ccgggaaagccagaagtgtccaatattacaaaaaacaccgttacagtgaattggaagagg
ccggcggatgacggcggcagtgaaatcactggttaccatgtggaaagaagagaaaagaaa
ggcgtgagatgggtcagagtttccaagaaaccagtgtcagaccttcggtacaaagtgact
ggacttcaagaaggaaatgaatacgaattcagagtcagcgcagaaaacagagcaggaatc
ggcccaccaagcgacgtttctcagccagtattaacgaaggatgctgcatacccaccagga
cctccttcaaacccacgagtaactgatacgacaaagacatctgctagcttatcatggggc
aaaccccattatgatggtggactggatatcattggctatgttgtggagcatcagaaagaa
ggagaagatgcatgggtaaaagatactacaggaactgctctaagaatcacagagtttgtt
gtcgctaatctccagccgggagccaaatacaattttagaattagtgccatcaacgctgct
ggtactggcgaacctgcaaagatcccaaatgttgaaatcaaggaacgtgaagtggctcct
gattttgaattagatgctgagctaagaaagacacttgttgtcagagccggactgagcatc
aggatatttgttccaattagaggacgtccagctcctgaagtgacatggacaaaggacgat
ataccactcaaagcacgtgccaatattgaaaatacagattctttctctcttctcatcatc
acagagtgtaatagatatgatgcaggaaagtatgtaatgacccttgaaaatgcggctgga
aagaagaccggttttgtcaatgtaagagttttggatacgcctgggccaccgataaatctg
aagcccagagacataagtaaagatagcatcactctccagtgggacatgccactaatcgat
ggtggttcacgcatcacaaattacatagttgagaaacgggagtctacgagaaaggcatat
tctaccatcaccacaaaatgccccaaatgctcccttaggattcccaatttagcagaaggg
tgtgaatattactttagagtcctggctgaaaatgaatttggaattggtgaacctgctgaa
accgctgaacctataagagcatctgaagcaccatcacctccagagagtcttaatattatg
gacatcacaaggaactccgtcagccttgcttggccaaagccagaacatgatggcggtagc
aagattactggctatgtgattgaggcacagaagaaaggttcaactcaatggacacacatc
acaactgtgaaaacattagaatgtgtggtcaagaacctcactgaaaatgaagagtatacc
ttccaggtgatggcagttaatagtgctgggagaagtgatccaagagaaagcaggccagtg
gttgtgaaagaacaaatgatgcttccagaatttgatttgcgtggcatatatcagaaaaca
gtcattgcaagagctggtgacaacatcaaagttgagattcctgtgcttggtcgcccaagg
ccaacgattgcctggaaaaaagaagaccagttgcttaagcaaacccaaagagtaaatgtt
gaaaataccgcaacagccaccatcttaaccatcaatgaatgcacaagaaatgacagcggc
agatatccagtctctgctaaaaacattgtcggagaagttagcgatgttataactgtacag
gtccatgatgttcctgggcctcctacaggaccaatcaaatttgatgaaatctcatctgac
tttgtcaccttttcatggcaaccacccctgaatgatggaggagttccaataagtaattac
gtcgtagaaatgcgcaaaacggacagtacatcatgggccgagttagcaactactgttatt
cgtaccacctataaagctgctcgcctcattactgggaccgagtaccaattccgtgttaaa
gcccagaacagatatggatcgggtccagccatcagttcagaaaatgtgatagctacctac
ccttttaaagttcctgggcctccaggcactcctcaagtgattgcagccacaaaagagtca
atcaccattagttggcatgagccacttacagatggaggaagtccaattctggggtatcac
attgaaagaaaagaacggaatagcatcctttggcagactgtaagcaaaaccttgatatca
ggcaacatcttcaaatcaagtggtctcacagatggcatcgcatatgaattccgagtcatc
gccgaaaacatggcaggcaaaagtaaaccaagcaagccgtctgagccaacacttgctctg
gaccctattgatcctcctggtaaaccagttcctctcaatattacaagacatgccgttgca
ctcaagtggacaaagcctgaatataatggaggctttaagataactggttacactgtagaa
aaaagagatcttcccaatggcagatggctcaaggcgaatttcagcaatatattagaaact
gaattcactgttagtggtcttaccgaagatgctgcttatgaattccgtgtgattgctaga
aatgctgctggtgctgtcagccagccctcagaaccatcagatgcgataacatgcagagat
gacatcgaagcaccaaggataatggttgatgctaaatacaaagaaactttagtattaaaa
gcaggtgaacttttcaaacttgaagctgatgttgcaggtcgccctccaccgacccttaca
tggaccaaagaaggaaaggagcttgaagacacggcaaaattggaaattaagatagcagat
ttctcaacagtccttactaacaaggattcaacaagaagagatggaggtgcatacacactt
acagcttccaatccaggtggctttgcaaaacatatcttcaatgtcaaagttctagacaga
ccgggtcctccagaagggcctttggcggtggctgatgttacctcagaaaaatgtgtcctt
tcatggttaccacctttggacgatggtggtgcaagcattgaccattacattgttgaaaaa
cgtgaaacaagtagattggcatggacaactgtagccacagaagttccagtaacaaaattg
aaggtcacaaagctcctgaaaggcaatgaatatgtgttccgtgttatggctgttaacaaa
tacggagttggtgaagctctggaatcagaacctgttctggcagtaaatccttacgttgtc
cctgatccacccaaaacacctgaagttacagctgctaacagggattctatggttgtatgc
tggggacgtcccgattcggatggtggaagtcctatcactaactacatcttagaacgtcgt
gacagagctggaatgcgctgggtgaaatgtaacaagcgagtggtcaccgatttacgctac
aaagtatctggactcacggaaggtcatgaatatgaataccgagtaaaggctgaaaatgct
gctggtgtaagcgaaccaagcccgagcagccagttctacaaagctgtcgatacggtgttt
aagcccggtccacctggcaatcctcgtgtcttagatacaagcaaatcctcaattacaatt
gcttggaataagcccatatatgatggtggctcagaaataacaggctacatggttgaaata
gcattaccagaagaagatgaatggaaaattgtcactccatcagcgggactgaaggctact
tcctttactatcactgatcttaaagaaaaccaggagtataaaatcaggatatatgccatg
aactctgaaggcatgggagagcctgctcaggttcctgggacaccaaaggccgaggaaagg
atgctgcccccagagattgaactggacgcagacctacgcaaagttgtcactctcagagct
tgctgtactttaagactttttgtcccaattaaaggaagaccggctcctgaagtgaaatgg
gcacgagagcatggagagtccttagataaagctacaatcgaatctacaagctcctatact
ctgcttacagttgcaaacgtgaataggtttgacagtggcaaatatatacttactgtagaa
aacagctctggcagcaaatcagcctttgtcattgtcagggttcttgatacacccggagcc
ccccagaatctaaaaataaaagaggtcacaaagtcatccgtcacactcacatgggaccct
cctctcatagatggtggctctaaaataaagaactatattattgaaaagcgtgaggcaaca
agaaaagcttactcaactgttatggccaactgccacaagaccagctggaaagtgacagat
ttacaggaaggttgtaactattatttcagagtccttgctgagaatgaatatggaataggc
cttcccgttgaaacaccggaatctgttaaagtatctgaacggccacttcctccaggaaaa
ataactttattggatgtgacaaggaacagtgtctccttgacctgggagaaacctgaacac
gacggaggtagcagaatcttgggctacattgtagaaatgcagagcaaaggcagtgacaaa
tgggccacctgtgccactgtcaaagttacggaagctgtcataactggactgattcagggt
gaagaatattcgttccgtgtttcagctcagaatgaaaaaggagtcagtgatcctcgacag
ttgagcgtaccagtaattgcaaaagatcttgtgataccaccagcctttaaactgttgttt
accactttcagtgtcctggcgggtgaagacttaaaggttgatgttccatttatcggccga
cccaagccaaccgtaacatggcttaaagataacgtgccactgagacaaactactagggtc
aatgaagaaaacacagagaacaacacgttactcacaatcaaggaagcatgtagggaagac
gttggacaatatttagtcaaactttctaattctgcaggtgaagcgactgaaattcttaac
attgtggtccttgataagccaggacctccaactggaccagtaaagattgatgaagtgact
gcggacagcatcaccatttcttgggaacccccaaaatatgatggcggcagttcaatcaac
aattacattgtagagaaacgggacacctctactactgtttggcagatcgtttcagctacc
gttgctcgaaccactctaaaagcaactaggctaaagactgggtgtgaatatcaattcaga
atcgctgctgaaaacagatacggaaagagtacgtatctcacgtcagagtctgtagttgcc
caatatccatacaaattacctggtccacctggaactccaaatgtaccacaagtctctaag
gacagcatggttgtgcactggaatgagcccgttaatgatggtggcagcaagattattgga
tatcatttggagtacaaggagagaaatagcatcctctgggttaaactaaacaaagcagcc
atccctgacacaaagtttaaagcaacgggacttgaagagggacttgaatatgaattcaga
gtttatgcagaaaatattgttggcattggaaaggcaagtaaaacttcagaatgctacgca
gcccatgatccttgtgatcctcccggtcgtccagagcccatcattgtcacacgtaactct
gttactcttcagtggaagaaaccagagtatgacggtggaagcaagatcacaggctatatt
gttgagaagaaggagctgccagatggccgttggatgaaagctagctttacaaacgtgatt
gagactcaatttgcagtaactggcctagtggaaaatcaaaggtatgagttccgtgtcatt
gcacgtaacgctgcaggtgtcttcagtgaaccatctgaaagttcaggggcagtcacagca
agagatgaagtagatccacctcgtataagtatggatcccaaatttaaagagacacttgta
ctgcatgctggcgaatcattcaaaattgatgccgatgtttatggcaaaccattgcctact
attcactggctgaaaggggataaggagctaacaaataccgcacgcttggacataaaaagt
actgactttgcgacaagcctcagtgtaaaagaagctattcgtgttgacagcggacattat
gtattgctggtgaagaatgttgcaggtgaaaaaacagcatctattcacgtcaaggttctt
gacaggcctggtccaccagaagggcctgctgttgtgacaggagttactgctgaaaaatgt
acgctgtcatggaagcccccactccaggatggtggcagcgatatttcccattatgttgtt
gaaagaagagaaacaagtcgcttagtttggactttagttgatgcaaatgtacagactctt
agctgcaaagttactaaacttttggaaggcaatgaatatatcttccgtatcatggctgtg
aacaaatatggtgttggtgagcctcttgaatctgaaccagtacttgcaaaaaatcctttc
gttgtgccactcccgccaaaagccccagaagtcaccgctgttaccaaggattctatgatt
gtggtctgggagagaccagcctctgatggcggcagcgaaatcttgggatatatactagaa
aaacgtgacaaagaaggcattcgatggaccagatgtaacaagcgtttgataagtgaactt
cgatacagagtcactggacttatagaaaatcacgattatgaatacagagtctcggctgaa
aatgcggctggtgtgagtgagcccagtccaccatctatttattataaagcctgtgaccct
atctacaaaccaggccctcctaataatccgagggcaacagatattacaaaatcttcagtc
ttcctttcctggggtaaaccaatctatgatggtggctctgaaattcaaggatacatcgtt
gaaaaatgtgatgtaagcgttggggactgggaaatttgtacaccaccaactggaattaag
aaaacaaatatggaggtggaaaaattattggaaaagcatgaatacaagttccgcatttgt
gctgttaataaagctggagtaggagagcatgctgatgttcctggaactattattgttgaa
gataagttggaagccccagaccttgatcttgacatggagctgaggaaagttatcaatgta
agagccggcggttccttaagattgtttgttccgatcagaggacgcccaacccctgaagta
aaatggggcaaggtggatggtgacatcagagaagcagctatgattgacatcaccagcagc
tttacctcactggttcttgacaatgttaacagatttgactctggaaaatacactcttact
ttggaaaacagcagtgggacgaagtctgcctttgtcagcgtaagagtcctagatacgcca
gggcccccaattaacctgaaaattagggagatcacaaaagactctgtttcacttgcatgg
gagcctcctttggtagatggcggagctaaaattaagaattatattattgaaaagcgtgag
gccacaagaaaagcctatgcagctgtagtaacaaactgcaacaaaacatcatggaaaatc
tctcagcttcaggagggctgctattattacttcagagtttgtgcagagaatgaatttgga
attggtttgcctgaagaaacccatgagccagtgaaagtcgctgaagttcctcaacctcca
ggaaagataacagtggatgacgttacaagaaacagtgtttcactgagctgggcaaagcct
gaacatgatggtggaagcaaaatcttacagtacatcgtggagatgcaagttaaaggcagt
gagaaatggtcagagtgtgcccgtgtcaaaattcttgaagccgttgttactaatctaact
caaggacaagaatatctctttagagtaatggctgtaaacgaaaaggggaagagtgaccca
cgatcacttgctgttccaataactgccaaagatttagttattgaaccagatgtaaggcca
gcattccacagttacagtgtccaagtgggtcaagatttaaagattgaagtaccaatatct
ggccgtcctaagcctacagtaacttggaccaaagatggcataccactaaaacagacaact
agagtcaatgtcattgattcacctaatcttaccaccctaagtgttaaagagaccgctaaa
gatgacagtggaatgtatgaagttgcagtggctaatgttgttgggcagaaatctgcatct
attgaaattataacactagacaaacctgatcctccaaaaggccctgttaaatttgatgat
atcagtgctgacagtattaccttatcatggaaccctccggcatatacaggtggctgccaa
attactaattacattgttcataagagagatacgaccaccacagtatgggagacagtttcg
actactgttgcaagaacaactctcaaagtgagcaagctgaaaacagggacagaatatcag
ttcagaatatttgcagaaaataggtatggacagagctttgccctggagtctgatgcagtg
gttgctcaatatccttataaagaaccgggtcctcctggtacaccatttgtgactgcagtt
acaaaagactctatggttgtgcagtggcatgaaccagtcaatgatggtggaagcaaaatt
ttaggttatcaccttgagaaaaaggaaagaaacagcattctgtggacaaaagtaaataag
acagtcattcaggacacacattataagacaactaaccttgaagaaggcattgaatacgaa
ttcagagtttctgcagaaaatattgtcggcatcggcaaaacaagcaaagtttctgagtgc
tatgtagcccgtgatccatgtgatccaccaggatgccctgaagcaattttggttaagagg
agctcaattactctgcagtggactaagccagaatatgatggtggcagcaaaattacaggc
tatatcgtggagaaacgtgatttgccagatggtcgctggatgaaagcaagctttaccaat
ataactgaaactcagtttactgtaacaggcctcactgaagaccaaagatatgaatttaga
gtaattgcaaggaatgctgctggaactgtaagcaaaccttcagatagcacaggaccaatc
acagcaaaagatgaagttgaacttccaagaatttccatggatccaaaatataaagacacc
attgttgtaaatgcaggagagacgttccgattggaagcagatgtccatgggaagccaatt
cctacaattatgtggctgaaaggagataaagtgcttgaagatactgcccgatatgaaata
aggaatactgacttcaaggctttgattactgtaaaagatgcaatacgtatcgacggtggg
caatatattttacaggcctccaatgttgcaggaaccaaatcggtaccaataacggtaaaa
gtactggacagaccagggcctccagagagtattaacgtttccggcgttacttgtgacaag
tgttccttgacgtgggcaccaccgatccatgatggtggcagtgatatttctcactatatc
attgagaagagagaaacaagtcgccttgcttggacagttgttgcttcagaagctgtagcc
acaatgctgaaggtaacaaagcttctggaaggaaatgagtacatcttccgcgtaatggca
gttaataaatatggagttggtgagcctctagaatctgcaccagtattaatgaaaaaccca
tttgttgtcccgggtccacccaagtccattgaagtcactaacattacaaaagattctatg
accgtctgctggaatcgtccagacagtgatggtggcagtgaaattattggctacatcgta
gagagacgagacagagctggtatcagatgggtgaaatgcaataaacgtcgaataacagat
ttgcgattaagagtcacgggactaacagaagatcatgaatatgaatttagagtgtctgct
gaaaatgcagctggagttggcgaaccaagtcaagtcacgccttactggaaagcatgtgac
cctatgttcaagcctggcccgcccacaaatgctcacattgtggatactacaaagaattca
attacagttgcatgggggaaacctatttatgatggcggcagtgacatcctaggatatatt
gtagaaatctgtaaagctgatgaagaagaatggtccatagttactccacagaccggtttg
agagtcaatcgttttgaggttgggaagctcattgagcaccaagagtacaaactaagagtg
tgtgccctcaacaaaattggagtcggggaggctgcggctgttcctggaaccgttaaaccg
gaagacaaactggaggctccagagcttgacatcgactcggagttaaggaagggaattgtg
gttagagctggtggatccgtcaggatacatataccattcaaaggacgccccactcctgaa
atcacctggtctcgagaagaaggagaattcacagataaagtccagattgaaaaaggcctc
agttacacacagctgtcaattgactattgtgatagaaacgatgctggaaagtatgttctg
aaactggagaacagcagtggctcaaagtctgcatttgtcacagttaaagtgctcgacaca
ccaggaccgccacaaaatttagttgtcaaagaaataaggaaagactacgctgtgttgacg
tgggaacccccagcgaatgacggcggtgcaaagataaagaactatgtaattgacaagcgt
gagtcaaccaggaaagcatacgccaacgtgagcaccaagtgtgccaaaacaagctttaga
gtggaaaatcttgcagaaggagcaatatattatttcagagttatggctgaaaatgagttt
ggcattggggttccagtcgaaacggcagatgcctccaaagcctcagagccacctttgcct
cctgggaaagtgacgctcaccgatgtgactcaaagaagtgcatcttttatgtgggagaaa
cctgaacatgatggaggtagccgaatactgggctacatcgttgaaatgcagccaaaggga
tctgataaatggtccgttgttactgaaaccaaagtgtgcaatgccgttgtgtctggtttg
agttctggacatgaatatcaattccgcgtcctggcatacaatgaaaaaggcaaaagtgac
cccagaccactggcagttcctgtgattgctagtgatctgacaattcagccaagtttcaaa
ctgatgttcaacacatacactgtacaagcaggagaagaccttaaagtagaaatacctttt
gtagctcgaccaaagcctactatcacttgggaaaaagatggtcagcctctcagacagaca
accagattacatgttgaagatacaccaacatcaactactttatatattaaagaaagcaac
aaagatgactttgggaaatatactgtaacagcaacgaaccctgcaggcaaagcaacagaa
aatattaatataattgtgttggagaaacctggcccaccacaaggacctgtccgctttgac
gaaattagtgcagattttgtggtcttctcatgggaaccaccagcatacacagggggctgc
cagatatccaattacattgtagagaagcgggatacaactaccaccacttggcagatggta
tcggcaacagttgcaagaacaacaattaaagtagcaaaacttaaaacgggtgcggaatac
cagtttagaattagtgcagaaaatcgttatggaaagagcacggcactagattctaagcca
gttgtcgtacagtatccatacaaggaaccagggccaccagggacaccgtttgtcacgaca
gccaccaaagaccacatgatcgtacagtggcatgaacccgttaatgatggaggaagcaga
gttcttggatatcacctagaacgtaaagacaaaaacagcattctttggacgaaggtgaat
aagaccctcattcaggatacaaaatgcaaaacagagggccttgaagaaggtcttgaatat
gaattcagagtttctgctgaaaacattgttggcattggcaagtttagcaagacttctgaa
ctgtattttgctcgagatgcttgtgacccaccaggccgtccagatgccatcgttatcact
agaaattatatcacactaaaatggaaaaaaccagagtacgatggtggcagcaaaataact
gggtatattgttgaaaagagagaattgcctgaaggtcgttggatgaaagccagttttacg
aatgtactagaaaccgagtttacagtaaccggtcttgtggaagaccaaagatatgaattc
agagtaattgcaaggaacgctgctggttgcataagtgaaccatctgaaagcacaggacca
attattgctagagatgaaattgaagcaccaagagcatcactggatccaaaatacaaagat
gtcattgttgttcatgctggagaaacatttgtccttgaagctgacattcatggcaaacct
gtacctgacattgtatggtcaaaagatggaaaagaatttgaagggccaactgcaagaaca
gaaataaagtccaccattcagagaacaactctcacagtcaaggattgcatcagagtagat
ggaggcctttacatgcttaagctgagcaatgtcggtggcacgaagtctataccaatcacc
gtaaaagtgcttgacagacctggacctccggaaggtcctttgaaagttacaggtgtgact
gcagagaaatgttacctggcatggggcccacctttacacgatggtggtgctagcatttca
cattatgtcatagaaaagagagagacaagccgcctttcgtggactcaagtggcatctgat
gtgcaagctctgaaccacaaagtaactagacttctcccaggcaatgagtacattttccgt
gtaatggccgtcaacaagtatggaactggtgaaccgctggaatctgagcctgtactggca
cagaatccatacagacccccaggacctccttcaatacctgaagtttctgcaatcacaaaa
gattccatgattgtaacctggggacgtccagctgataacggtggagctgaaattgaaggt
tacatactagaaaagagagacaaagatggtgtccgatgggtcaaatgcaataaaaagaga
ctgacagacttacgatacagagtaactggacttactgatgggcatttctatgagtttagg
gtttctgctgaaaatgctgctggggttggtgaacctagtgaaccatcagtcttctaccgg
gcgtgtgatgcagtgtatcctccgggacctccaagcaatccaaaggtgacagatacctcc
agatcttctgtgtcacttgcatggaacaagcccatttatgatggaggtgctcctgtttta
ggatacattgttgaatttaaagaagccactgctgatgagtggacaacctgcacaccgcct
tctggattacaaggaaaactattcacagtaacaaatctcaaagagaatagtgaatataac
ttccgcatctgtgctatcaacattgaaggagttggagaaccagcgaccatacccggtagt
gttgctgctgctgataaaattgaacctcccgaaattgaacttgatgcagatctcagaaaa
gttgtcacagtacgtgctagcggcaccttgcggttgtttgtcactatcaaaggcagacca
gagccagaagtaaaatgggaaaaagcagaaggccggctgagtgacagagctcagattgag
gttaccagttcatatacgatgttggttattgataatgtcaacagattcgacagcggcaag
tatatcctgactttagaaaacaatagtggcaagaaatctgcttttgttaatgtgagagtg
ctcgacacaccaagtgcacctgtcaatctggtcgtcagagaagtgaagaaagatttggtg
acattagcttgggaggctccacttattgatggcggatctaaaattacaaattacatcgtt
gaaaaacgagaaacaaccagaaaagcgtacgccacaattacgaacaattgcactaagaat
gtattcagaattgaacagcttcaggagggatgcagttactatttccgagtcttggctgca
aatgaatatggagttggcttgccagcagaaacatcggaaccagtgaaggtttctgaacca
ccctatccacctggaaaagtaactcttgtcgatgttacacgcaacagtgctaccatacag
tgggagaaaccagagagtgatggtggtagtaaaataactggctatgtagtagaaatgcaa
actaaaggaagtgaaaagtggagcacctgcacacaagttaaaacattagaggcaaaaata
tcaggattaactatgggagaagaatatacattccgagtccgtgctgttaatgagaaaggg
aaaagtgatccaagacagcttggagttcctgttgttgccaaggatattgaaatccagcct
tcagttgagctccttttcaatactttcagtgtgaaagctggtgaagaccttaagatagat
gtgcccatcagaggaaggccgattccatcagttagctggaagaaagatgggctgccttta
agagagacaactagggtaaatgtccacacatcacaaacgtcaactttactaaccatcaag
gaagcttcaagagaagatgtaggaagttacgaattaagtgcttcaagcagtgctggctct
acaacagcttccatcactgtaattgtacttgacaagcctggacctccaactgcattacat
attgataatgtcagtaatgataacataacaatatcttggaaacctcctgagtatgatggt
ggctgtcaaattaataattatattgtggagaagagagaaacaactacaaccacatggagt
atagtgtccgccaccgttgcacgaacttcaattaaaataatgcgcttaatcacaggatct
gagtatcaattccgtgtttctgcagaaaatcgctatggaaagagtgcctacattgaaacg
gcccctgttgttgcagagtatccatttagtcctcctggtccacctagcactcccaaagtt
gtacatgcaacaaaagcattcatgattgtaagctggcaagaaccagttaacgatggagga
agcagagtacttggctaccatcttgagcataaagaacgaagcagcatcctttggactaaa
gtaaataaaactcttataagtgacacacagatgaaggtaacaggccttgatgaaggacta
atgtatgaatatcgtgtctatgctgaaaatattgtaggaataggtaaatgtagcaagtct
tgtgagcctgttgctgcaagagacccatgtgatcctcctggtcagccagaagtaactaat
attacaaggacatgtgtctcactttcatgggccaaaccagaatacgatggtggtgctaag
ataacaggctacattattgaacggaaagagctaccagatggtcgctggctgaaatgcaac
ttcaccaatgtacaagaaaccttctttgatgtcacagggcttactgaagaccagcggtat
gaattccgcgttattgcaagaaatgctgctggactgtttagtgagccatctgaatcgact
gggccagtgactgtaaaggatgatgttgaagctccaagaattatgatggacatcaaattc
agggatgttgttgttgttaaagctggggagatcttgaaaatcaatgctgatattgcagga
cgacccttgccagtagtttcatgggcaaaggatggcaaagagcttgaggggaaagcgaga
gttgaaattgcttcagccgatcgccatacttcaatcactgttaaagactgtattcgacgc
gattcagggcaatatgtgttaacgttacagaatgttgctggaacacgatcattagctgtc
aactgcaaagtacttgatagacctggtccaccagcaggcccgctagaaatcaaaggactt
actgctgagaaatgtcacctatcatggggaccacctcaagaaaatgggggtgcagaaatt
gattactatatcgtagaaaagcgtgagaccagtagaattgcatggactctctgtgaagga
gagcttccaacaacatcctgcaaagtgacaaaactacttcgagggaacgaatatatcttc
agagtcatgggtgtcaacaaatatggtgttggtgaaccgttggaaagtgaggcagtcaag
gctctggatccttttactgttccatccccacctaaatctttagaggttactagtgtgaca
aaggagtccatgaccctctgctgggcgagacccgacagcgatggaggcaatgaaattgct
ggatacgtgattgaaaggcgtgagaaaaatagtctgcgctggatacgtgtaaacaaaaag
ccagtttatgatctcagaataaaatcttcaggccttcgagaaggatgtgaatatgaatat
cgtgtatatgcagaaaatgctgcaggtcttagtcttcctagtgaaacttcacctctaata
aaagcagaggatccagttttcttgccatcacctccctcaaggcccaaaattgtggactct
acaaggtcaaacataacaattggatggttgaagccattatttgacggaggctctcctgtt
actgggtatacagttgaatacaaactaactagtgaaacagactggtcaacggccattcaa
ggcttaagaggcacagagtatactgtcattggacttacctcaggagcggaatatgttttc
agagtaaggtccctcaacaaagttggtgctagcgatccaagtgaggtctcagaaccacaa
gtagcaaaagaaagggaagaagaacctgcctttgaaatcgataatgaaatgaggaaaacg
ctgattgtgaaagctggtggatcatttacaatgactgtgcctttcagaggaaaacctgtt
ccaaatgtattgtggaataagccagatactgatctccggacacgagctaatattgactct
tcagacaactgcacctcacttaccattgaaaaagcgacaaggaatgattctgggaaatat
acactgacattacaaaatattgtaaacacagctactttgacattagttgtcaaagttctt
gattcaccaggacctccttctaatattattgtaaaagatgtaaccaaagaatcagctgtc
ctgtcttgggaagctcctgagaatgatggaggcgctccagtgaagaactattacattgaa
aaacgggaagcaagcaagaaagcctgggtcactgtcaccaacaactgtcatcgtctttcc
tacaaagtcaccagtctacaagaaggcgggatttattacttcagagtctctggagaaaat
gaatttggagtcggagtccccattgaaactaaggatggaacgaaaataacagaaaagcca
agtccaccagaaaagctgggagtagcaagtgttactaaagacagcgtctctcttgtgtgg
ctaaagccagaacacgatggtggaagtcgaattgttggctaccttgttgaagctcaggag
aaagggcagcaaaaatgggtcaaatgtgcagtagtcaagacaactcatcatattgtccac
ggtctcaaggagaatacagaatacttcttcagagtatttgccgaaaaccaagctggctta
agtgacccgaaagagatgcctcttgctgtcacagttaaggatcaactggaatccccagag
gttgacatgaaaggtttccccaacaacacagtttacgtacgcgcaggttcaaatctcaag
gttgagattccactttcgggaaaaccattaccaaaagtgactttatccaaagacggtgtt
cctatcagaccaaccatgaggttcaacacagaaacgacagcggaaagtgtcataatcaac
ctcaaagaaagtgtggctgctgatgccggtagatatgacattacagctgccaactccagt
ggaactactaaatcattcattaaaattgttgtcctggacagaccaggccctcctgtcggc
cccgtggtccttagtgacatcaccgaagaaagtgttaccctgaagtgggagtcacccctt
tatgatggcggaagtcaagtgacaaactacattgtgctgaaaagagaaacaagcactgct
gtgtggtctgaagtgtctgcaacagttgctagaaatataattaaaataatgaagctaaca
acaggagaagaatatcagttccgtatcaaagcagaaaatcgctttggcataagtgaccat
attgactcagcctgtgtaactatcaagctgccttacacaactcctggacctccttccaca
ccatggattactcatgtaacacgagaaagcattacagttggatggcacgaacctgtttcc
aatggaggcagtccagtcattggctatcatcttgagatgaaggacaggaacagtatctta
tggaagaaagccaacaaaatgattatacgcacaagccatttcaaggtttccaacatcagt
gctggacttatctatgaattcagggtttgtgcagaaaatgcagctggcattggaaagcca
agtcacccatctgatgcagttcttgctattgatgcttgtgagccgccaagaaatcttcgt
gtcacggatatttccaagacatttgtcagcctttcttggatgcagccagcttttgatggc
ggtagcaaaattactgggtatattgttgaaaaacgtgatcttccaaatggaaggtggaca
aaggctagcttcaccaatgtcatcgagactcagtttacggtgtccgggttgactcagaac
tcccagtatgaattccgtgtttttgctaagaatgctgcaggctcagttagtaatccatca
gatgttttaggccccatcacctgtgtggacacatatggtgcacctgaaatagatgtacca
ccagaatacacagaagtggtcaaatacaaagctggcactgccgttaagctgaaacttggc
atttcaggaaagcccatccctacaattgaatggttcagaaatggtaaagaaatacaaacc
agtgcccagatttctattgaaaacaccaccgaattttcagccatcctgatcaaagatgca
actcgtcttaacagtggcagttatgagttgaaattaaagaacgccatgggttctgcatct
gccacggttcgggtacaaatacttgataagccgggacctcccggcggacctgtacagttc
agaaccgtcactgctgaaaagatcaccattatgtgggatccgccagcggacgacggaggt
gcaagtataacacattacattgttgaaaaacgtgagacaagccgcgtggtatggtctgta
gtttcagaaaagcaagaggaatgtattgtcaccaccacgaaaatcataaaaggaaatgaa
tacatattccgcatacgagcggtaaacaagtttggtgttggcgagcctctggaatcagat
gctgtcgtagccaagaatgcatttgttacacctggacagcctggtgtgccagaagtcacc
atgataacaaaacaatcgatgactgtcttctggagcagacctactgtggatggcggtagt
gaaataagtggatattaccttgagaagcgtgataagaaaagtctaagctggttcaagatc
actaaagaaaccatccgtgacaccagacagaaagtgacaggactaactgagaacagtgaa
taccagttcagagtttctgctgtgaatgcagctggacaaggtcccttctcagaggcctct
gacttcttcaaagcggcagatcctattgacaaacctggaccacctgtaaagctgaaggtt
gtggatactacaaagacctccatcacacttagatgggctaaaccagcctatgatggagga
agtgcaattaccagctatgcgatcgaaaagagagaagcggaggaggaagaatggactgtg
gtcagtgccagaggagaagtgagaaccactgagtatgttgtttctaatcttcagccagga
atcaattattacttccgtgtagctgcaataaattatgctggacaaggggaacctattgaa
atgactgaacccgtacaagcgaaagatatacttgaggagccagagattgatctggacgtc
gctctcagaacctccatcgtagctaaagcgggcgaagatgtgcaaataatgattccgttt
aaaggaagacctcctccaactgtcacatggagaaagggcgataaaaatcttggtacagat
gaacggtatagcattcagaacacagagtcgtctacactacttactattcctcaggttgat
cgcaatgatacagggaaatacgtgctcaccatcgagaatggagttgggaaacccaaaact
tcattcgtgaatgttaaagtacttgacactccatctgcctgccagagacttcatctgaaa
aatgtttcccgtggaactgtgaccttggtgtgggaacccccactcatcaatggtggctct
gaagtaacaaattatgtcattgaaaaaagagatgctacaaagagagcttggtctaccgtg
acggcgaagtgctctcacacaacatttaagataactggcctgtcagaaaaaatcccatac
ttcttccgtgtgatggcagaaaatgagaatggattgggtgagccgtgtgaaaccacagaa
cctgtgaaagctgccgaagtcccaggacctgtacgagacctggccatgaaagattcaacc
aagacctcggtcactttacagtggagcaaacctgactttgacggtggtagcatcatatca
gagtacatcattgaaaagagactgaaggatgagacggaatggtcctttgcagggacaagt
aaagcatgcgaatttgaagctgagaaacttaaggagctttcagttgtggaattcagagtg
tccgctaagaatgaaaaaggaagaagcgacggtgttacaactggtcccattacagtgaaa
gactatataatagtacctgaagcagacctttccgatatacctggaggacaggtgaccgtg
agaataggacataacgtccacattgaattgccttataagggaaagccaaggccaactatg
agttggctgaaagacaacatccctctgaaagaaagtgagcatattcgtttcaagaaaaca
gaaaacaaaataactttaagcatcagaaatgcgaaaaaagaatatggcggcaaatatacc
ttgattcttgacaatggtgtccacagaaagacattcccaattacagttataacactgggt
cctccatctaagccaaaaggacctataaaattagaggaaatcaaagcagacagtatggtt
ctttcatggggagctcctgaagatgacggaggaggagaaataactggctacagtgttgag
aaacgggaaacgtcccaaaccaactggaaaatggtgtgttctagtgcagaaaagacaacc
ttcaaagtccccaaccttgttaaagatacagaatatcagtttagaatccgtgcagaaaac
agatacggagtgagcccgccactgaactctgtagaggtcatagcgaagcaccagttcaaa
ccaccaggttcacccgggaaaccagtagtttacaatgtaacagctgatggaatgaccata
tcttgggatgctccagtttatgatggaggtgcagaaattactggataccatgtagaaaag
aaagaaagaaatagcattctctggcagaaagtaaacatttcatcaatatctagcagagaa
cacagaattactggtttgatggaaggcttggactaccagttccgtgtatatgcagaaaat
tcagctggattaagcaatcctagtgatccaagcaaatttacactggcggtctctccagtt
gatccccctggcactcctgattatatcgacgtgacaagggaaaccattactctgaagtgg
accgcacctgtgcgggatggaggcagcaagatcgtaggctacagcatcgagaaacggcaa
ggaagtggcgaccgctgggtcagatgcaattttaccgatgtcactgaatgccagtataca
gctacaggacttagccctggtgatcggtatgagttcagaatacttgcaagaaatgctgtt
ggaacaatcagtcctccttcacagtcttcaggctatatcatgactagagatgaagctgtt
cctccaaatattgaatttggtgccgagcattttgaaggccttactgtgaaagctggagaa
agcatccgacttaaagttctcatcaccggccggccagttcctcaggtgacctggtttaaa
gatggcaaagaaattgataagagactgaatctagaaatcactagtgccattggctacagt
actgtctttgtcagagatgcctctcgagatcatcgtggagtttatcgagtagaagccaag
aatgcttcgggagtgaaacaggcagaaatcaccataagggtgcaagataccccgggacaa
gtcggtgggccaatacgatttaccaatattactgaggagaaggcaacattatggtgggaa
cctccagctaatgatggctgtgcagccattactcattatgtgattgaaaagcgtgaaacc
agcagagtatcctgggcactcattgaagacaactgcgaagcctgcagctatacagcactt
aagttaattaaaggcaacgagtaccagttccgtgtctctgcagctaacaagtttggtgtc
ggccggccattggaatctgatccattcgtagcccagccccattacactgttcctgatgct
cctggaactccagaaccaagcaacgtgacaggaaatagtatcacactcacatgggaaagg
ccagcatcagatggtgggagtgatattgatcagtatatcttggagagaagagagaagaag
agtattcgttgggttagagtacccagcaagagaccaattgcagagacaagattcagagtc
actggcctaactgaaggcaatgaatacgagttccaggttatggcagagaataaggctgga
gtcgggccaccaagtggtatctcaaggctgatcaagtgcagggagcaagttcacccaccc
agcgctcctactgtggtcaaagtgacagacacctcaaagacaagtgtcagcctagaatgg
acaaagccagtttttgatggaggcctggaaatcattggctacatcatcgaaatgtgcaaa
gctgacttgggagagtggcacaaagtcaatgcggagacttgcattgcgaccaagtacacc
gtgattgatctagaacccaacgagcactacaaattccgagtcagtgccgtaaatggtgca
ggcagaggagaaagctgcgaagttgctgcttcaatccaaacagtcgataggctttcctcg
cccgaacttgatattgatgctaacttcaagcagacccatattgttagggcaggtgcaagc
atccgcctattcattgcctaccgcggccggcctgttcctacagctacgtggtccaaagca
gattccaatcttaacttacgtgctaacattcagacaacagactcattcagcacattaacg
gtggagaactgcaatagaacagacgcgggcaaatacgttttcactgtggaaaacaacagt
ggtagcaaagccattactttcactgttaaagtgctagatacccctgggccacccggtccc
attacatttaaggacgtggctagagactctatcactttaatgtgggatgctcccgttttg
gacggaggtgcccgcatccaccattatattgtggagaagcgagaagcaagccgccgcagc
tggcaaattgttcacgaaaaatgtactcgacagatttgcaaggtctcggaccttgcagaa
ggtgtgccctatttttaccgtgtttctgcagaaaatgaatatggagtaggtgaaccctgt
gagttaacagagccagttgtagccactgaagagcccgctccacctaagagactggatatt
gtggacaccactaggtcatctgtggaactagcttggctgaaacctgatcatgacggtggc
agtcgtatcattggataccgcatcgagatgaaacagaagggatctgatgtttgggtggaa
gctggtgaaaccaaacagctaacttttacagttgaaggtctcatagagaacaatgagtat
gagttccgtgtcaaagccaagaacagtgccggttacagtcagccaagagaagccttctct
tctgtcatcattaaagaacctcaaattgaaccaactgctgatctcagtggaataactaga
caacttataacctgcaaagctggaagcacctttaccattgacatcccgatcagtggacgt
ccggtgccaaaggtaacatggaaacttgaagaaatgagactaaaggaaactgacagagtg
actatcaagacaacaaaggatagaacgacaatgatagtcaaggacagcatgagaggtgac
tctggtaaatattacttgactctcgagaacaccgctggtgtgaaaacattcactgtcaca
gtcattgttattggaagaccaggtccagttacacggccagtagaaatatcatctgtgaca
gctgaatcctgtgtattgtcgtggagagagcctgaagatgatggcggcagtgagattaca
aactacattgttgaaaaacgcgaatctggtacaacagcatggcaactggtaaattccagt
gtcaaacgtacacagatcaaagtaactcatctcacaaaatacatggaatataccttccgt
gtcagctctgaaaacagatttggtgtcagcaagccagtggaatcagtaccagttgtggct
gaacatccatttgtcccaccgagctcaccaaccagaccagaggtctactatgtttctgcc
aatgccatgtcaattcggtgggaggaaccgtatcatgacggtggcagcaaagtcattggg
tactggattgaaaagaaagaacgcaacacaatcctttgggtgaaagaaaataaaactcca
tgctgtgaatgtgactacaaggttacagggcttgtcgaaggcctggagtaccaattcaga
gtatatgcattgaattcggctggagtgagcaaagctagtgaagcttccaggcccgtattg
gcccaaaaccccgttgatccaccaggcagaccagaagtaacagatgtcaccaggtcttca
gtgtcattaacctggactccaccactttatgatggtggaagcaaagttgtcggctatatt
atagaacgcaagccatacaatgaagctggagatggacgctggctaaaatgcaactacacc
atcgtctcagaaaacttcttcactgtgacggctctcagtgaaggagaagcatatgaattc
cgtgtgttggcaaagaatgctgctggtgtaattagcaaaggttctgaatcgactggtgcc
gttgcctgtagggatgaatactcaccacctaaagctgaactggatgccaagttgaaagga
gaggttgtaactgtaagagctggatccgatcttgttcttgaggcatcaattggtgggaaa
cccgagcctaaagtcttttggtctaagggtgacaaagagttggacccgtccgaaaagatc
tccttgcaatatacaagcaagcatgccattgcaatcatcaaattctgtgacagaaatgac
actggaaaatacacgttaactgttaaaaaccccagtggcacaaagcacgtcgctgtcctt
gtcaaagtgcttgattctcctggtccatgtgctggcaaaatcaccattagcagagtaaca
gaggaaaagtgcaccctagcttggaatagtccccaagaagacggaggggcagaaatcaca
cattacattgtagagaggcgtgagaccagcaggctgaactgggtcattgtagaagccgaa
tgtcaaacattatcatgcgtcgtaacaagactcattaggaacaatgaatacatcttccgt
gtgagagctgtcaacaaatatggaccaggtgttccacttgaaacagaagccattattgct
agaaattctttcactattccatcacctccaggcgtgcctgtagcagtgggtgttggcaaa
gaacacgtcattatccagtggcagaaaccagagtcagatgggggtagtgagattagcacc
tatcttgtagacaagcgggaaaagagaagtctacgctggacacgagttaacaaagacttt
atcatctatgatacacggctgaaagttactggcctgatggaaggcagtgattatcagttc
cgtgtcacagccgtaaacgccgctggtaacagtgagcccagcgatgcttctcagtatgtg
ttgtgcaaagatccatcatacactccagcaccaccatcacctccaagagttgtggacact
acaaagaccagcataagcttggcttggacaaagcccatgtacgatggtggagttgacatc
ttaggctacgttcttgaaatgaaagaagaaggtaccgatcagtggtatagggcacatagt
actgccaccataaggaacgcggaattcaccgtcacgggtcttaaaacaagccagaaatac
cgcttcagggtggctgctaccaatattaatggtatgagtgaatacagtgagtcatctgcc
gaaatagaacctgtggaaagaatagaaataccagatcttgagcttgctgatgatctaaag
aagactgttactgttagagcaggtggctccttgcgtctaatggtgtccgtatctggcaga
ccaccaccaataatcacatggaacaaaaagggtgttgaccttgcaagtcgcggtattatt
gacattacagacagttataccctgttggttgtggataaggttaaccgatatgatgctggg
aaatacgtcattgaagctgaaaatcagtcaggaaagaaatctgcatcaattattgtaaaa
gtctacgatactcctggcccaccaggatctgtgaaggtcaaagaggtctcaaaggactcc
gtgacaattacctgggaaattcctaccattgatggtggtgctccagtcagcaactacata
attgagaaacgggaggctgccatgagagcctacaagactgtaacaactaaatgtagcaaa
accctttatcgaatttctggactcattgagggagccctctattacttccgtgtgttgcca
gaaaacatctacggtattggtgagccctgtgagacatcagatgcagtgttggtgtcagag
gtcccgactgcaccgcagaaattggaagtggtagacgttactaaatctactgtatcactt
gcatgggacaaaccacaacatgatggtggcagcagattaactggctatgtaatcgaggcc
agtaaagctggaagtgaaaggtggatgaaagtggtaaccctgaaacctacagtcttggaa
cacacaataatttcattaaatgaaggtgaacagtacctgtttagagtcagagcccaaaat
cagaagggcgtgtctgaagcaagagagatagtcacagcagtgacagtacaagaattaaaa
gttgtacctgcaatggatcttgctggaatacctcaaaagacccttcatgtaccagctggc
aaaccaatagagctagctattccaatttctggaagacccccaccagctgtttcttggttc
tttgctggctctaaactaagagaatcagagcgtgtcaaagttgaaactgttgccaaggtc
acgaaactaaccattcgtgaaaccacaatacatgacactggggaatatacgctagaactg
aagaatacatctggaactgctcttgaaagaataaaagttattatccttgacaaacctggg
ccacccactggacctattaaagttgttgatattgattcaacttttgtaaccatttcctgg
gaaccccctgagatggatggtggtgcagccctcagtggctatgtggtggagcaacgtgat
gctcatcgtcccggatggctgccagtgtctgaatctgtaactcggacaacatttaagttt
agtaaacttactgagggtgccgaatacgtcttccgtgtggctgccaccaatcgctttgga
attgggtcatacttgcagtctgaaatcatcgaatgcaagagcagaatcagtcttcctggc
ccacctggtaccccagaagtatttgatatctcccgcgatggaatgacactgacttggtat
ccaccagaagaggatggtggttcacagatctctggctacattgtggaacgcaaagaagtt
agatcggacaaatgggtccgtgtcaataaagttgcagtgactatgacgcgctatcgatct
gctgggctggttgaaggattggagtacgaacaccgtatcacagcggtcaatgctcggggt
agtggcaaaccaagccgaccttccaaatcagcagtggctagagatccaatagctcctcca
ggcaaacctcagaatccaagagttacagataccacaagaacatccatttccctggcttgg
agtccgccagaagatgaaggcgggtctaaagtcagtggctacttgattgaaatgcaaaag
gttgatcagtttgaatggacgaaatgcaacaccactcccaccaagatccgcgaatacacg
ttaacgcatcttccacaaggtgcagagtacagattccgtgttctggcttgtaatgcagga
ggtccaggtgaacctgccgaggtgccaggaacagctaaagtaaccgaaatgcttgaatta
cctgattatgaacttgatgaaaaatacctggaaggcatctttgtgagacaaggtggagta
attaagcttacaataccaattaaaggtaaacctattccaatatgcaaatggactaaagaa
gggaatgacgtctccaagagagccatgattgccacctctgaatcacacactgaacttgtg
ataaaagaggcagagagagaagattctggtacctatgacttgacactggaaaacaagtgt
ggcaagaaggttgtatacatcaaagtcagagtaattggcactcccaatccgccagaaggg
ccgcttgagtatgacgacatacaagcgcgctctgtcagggtcagctggaaacctcccact
gatgacggtggcgcagacctcctgggatatattgttgaaaggcgtgaagtaccaaagact
gcatggtacacggtggatgccagggtaaagggtacctcattagtagtgaaaggactcaaa
gaaaatgtggaatatcacttccgggtttctgctgaaaaccagtttggcataagcaaatcc
ctgaaatccgaggagcctgttgtgcccaaaacacctttgcatcctccagagcctccgagt
tacccaccagaaatactcgatgtcacaaagagttccattagcttgacttggtccagacct
agagatgatggtggctctcgtgtcactggctactatattgagcggagagaaacatctact
gagaaatgggtcaggcacaacaagactcacatcacaaccacaatgtacacactcacgggg
ctaatccctgatgctgaatatcaattccgcattgtggctcaaaacgatattggggagagt
gaaccaagtcctacttctgagcctgtggtgtgcaaggatccatttgataaaccaagccaa
cctggagaaattgaaatcacatccatatctaaggacagcattactttagaatgggagaga
cctgaatgtgatggtggtaaagatatcatcggatactgggttgaatatcgccagtctgga
gaggcaacatggaagaagtgcaatagagagcgtatcaaagacaggcagtttatcatgggt
ggcttacttgaagctacagaatatgaattcagagtctttgcagaaaatgaaactggaatt
ggcagacctcgtagaactgcgatggcagtgaagaccaagctgacatctggagaagcacca
ggaataaggcaagaaattaaggacgtcactacaaatctgggcgaaccaggtcagctatcg
tgccagattgtcggtaggccacttcctgacattaagtggtatcgttttggcaaggaactg
atacagagccggaaatacaagatgtcctcagatggacgcacccacacactgaccgtcctc
acagaagagcaggaagatgaaggcctttatacttgcagggctgtcaatgaagttggggag
attgaaactagcggcaagctattattacaggctccccctcaattccatcctggcttccca
ctgaaagagaaatatcgtgcaggtgtaggctctactcttcggctccatgtggtatacatt
ggccgtccggtacctgctatcacttggttccatggcaagaaacttctgaagaacacagaa
actattaccatagagaacacagagcattatacccaccttgtcattaaaaacgtacagcat
aagacccatgcaggaaagtacaaggtgcaacttagcaacacatttggaacagttgatacc
gtactcaatgtggaaatacaagataagccagataaaccagcaggaccaattgttgtggaa
gctttactgaagaattctgtggtcattagctggaaaccacctgaagatgatggaggggcc
ttagtaacaaattatgtcgtagagaaaagagaagcaaaagaaggagcagagtggcagctg
gtgtcctcaagcatttccagcacaacttgtagaattgtcaacctgacggaaaatgcagga
tactatttccgtgtctttgcccagaatacatttggaatcagtgaagcgctggaggtttca
tctgttgtagtcgtcaagactccatttgaaaaaccaggcccgccaagtaaaccagttgca
tccgctgtgacaatcgattcctgtgttgtggcctggaagccccccgtcagtgatggtggc
tccaagatcaggaattactaccttgagaaacgtgaaaagaagcaaaacaaatggattgct
gtgacaaccgaagaaattcacgaaaccgtctatactgccacaagtcttattgaaggcctt
gaatatgaattccgagtaaaatgtgaaaatctaggcggtgagagtgaatggagtgacatt
tcagaaccaatcactcccaaatctgatgtgccagttcaggccccacacttcaaggaagaa
atcagaaacctgaacgtgaggtacagaggccatgccacattcgtttgcaaagtcaccggt
caccctaaacctattgtaaaatggttcaggcaagggaaagagattttgccagatggcgag
aaggtgaagattcaagagtttaagggtgggtatcaccagctggtgattacagacgtaacc
gatgaggatgccacggtgtatcaagtgagagcgaccaaccaaggaggatctgtgtccgga
aatgcctccttagatgttgaagttcctgccaagattcacttgcctaaaaatctggaaggc
atgggggctgtccatgctctccgtggtgaagtggttagcatcaaaatcccattcagtggc
aagcctgatccagtgatcacatggcagaaaggacaagatctcattgatactaatggtcac
taccaagttattgttacccgttctttcacatctcttgttttcccgaatggtgtggaccga
aaagatgcaggtttctacattgtctgtgctaaaaacagatttggcattgaccagaaaaca
gttgaattagatgtggctgatgtccccgatccaccaagaggactgaaggccagtgaggtt
tcaagagactcagtcaacttaacgtggaacgctccagctaacgatggtggaagcagggtc
acacactataccgttgagaaacgtgctactacagccgagcgatggatacgtgttggccaa
gcacgcgacacacgatacactgtggtgaacctatttggcaagacaagctacgtattccgt
gttatagcagagaataaatttggccaaagccagccttctgaaccaaccgatcctgttata
acaaaggaagataagactagaacagtaaattatgatgaagaagtggatgaggccagagaa
gtcaccacagcgaaggcagctcactcttcaaccaaagaactctatgacagatacatgatt
gctgaagaacttgggcgtggccaatttggaattgcccatcggtgtgttgagactgtttct
aagaagacatacttagccaagtttgtcaaagtaaaaggcgctgaccaagttctagtaaag
aaagaaatttccatcctaaacatcgctaggcacagaaatatcctatatcttcatgaatct
tttgaaagtctagaagaattgatcatgatctcggagttcatttccggagttgacattttc
gaaagacttaatacccctgcatttgagtttaatgaaagagaaattgtaagctacgtacgt
caagtatgtgaagcacttgaattcctacacagtcacagcattgggcacttcgatatcagg
ccagagaacattatttacttcacgagaaggagctctgtaattaaaatcattgagtttggt
caggcaaggcagctgaaacctggtgataatttcaggctccagttcacttctcctgaatat
tatggacctgaggtccaccagcacgatttggtcagcactgccactgatatgtggtcactt
ggaaccctggtgtatgtacttttgagtggcctgaatcctttcattgctgaaacaaaccaa
cagacaattgaaaacatcatcaatgctgaatacaattttgatgatgaagcattcaaagac
atcagtatcgaggccatggatttcattgaccgcctgctagtaaaagaaaggaaagctcgt
atgactgctgctgaagcccttgaacatacttggctgaagcaaagaacagaaaaaaccagc
actaaagtaatcaaaacactcagacacagacgttattaccaaaccttggtgaagaaggaa
tggaacacagttgtctcagtagcccgtgttgcatggggtggtgcaatccggtctcagagg
ggtgttacagtggctaaagtcaaagtggcatccattgaaattggacctattactgggcag
atcatgcatgttgctggggaagaaggtgggcatgccaagtacgtctgcaagattgaaaac
tatgactcatccacagaagtgacctggtactttggagtcagacagctgcagcacagtgag
aaatatgaaatcagctaccacgaaggagtggccacaatgtatgtcaaagatattgctaaa
tcagatgatggcacctacagatgcaaagttgcaaatgactatggtgaagatagttcctat
gcagagctatttgttaaaggtgtgagagaagcttctgactattacagatgcagaactgtt
aggagagtgaagcgtcgtgtagatacaatgagacttctggaaaaaccaccagaatttact
ctgcctctctataaccgtactgcctacgtgggtgaaaatgtcaggtttggggtaactata
acagttcatccagaacctcgtgtaacgtggttcagatcaggtcagaagatcaagccagga
gatgatgacagaaaatatacctttgaatctgacaagggtctttatcagctcctcatccat
aacgtcaatgaagatgatgacgctgaatacactgtgctagcacgcaacaaatatggtgag
gacagctgcaaagcgaagttaactgttgttcatcatgctcctccagaggaaaccaccttg
agacctatgtttaaaagactgttggcaaattcagaatgccaagaaggccacagtgtctgc
tttgagataagagtatctggtataccaaaaccaacactaaaatgggagaaagatggccag
cctctagcagctagccccaatattgaaattgtgcatgaagggttagattactacgctttg
cacatcagggacactctaccagaagacagtggttattacagagttactgcgacaaacaac
gctggttccacaagctgccaagcttatttgaaagtggaacgcttgagatatgtcaagcgt
gaatacgagtctgtagaagagcgggaaaagcttgtacggaagagaattgacaagacagcg
agaatggcagaaattctttctcgaacagaagctgttccactgacacaagtagcacaggaa
gctctgaggcaggctgccatcatgtataaaccagctgtaagcaccaagacggtcaaaggg
gagtttgaacttaaagcggaagaagtgaaagaagaaaagagacttcggatgccatacgag
atcccagagcctcgcagacgtgcggccactgctcttgaagaagatcagaacatcaagttg
tttgtgcctatgtcagacatgaagtggtacaagaagctaagagatcaatacgaaatgcca
ggaaaactggacagaattgttcagaagcggcctaagcgcattcgactttccagatgggaa
caattctatgtgatgccactgccccgcattactgatcaatataaacctaagtggcgcata
cctaaactgtcgcaagatgatcttgagatagtgaggccagcacgccggcgtactccatct
cctgattatgagttttattacaggccaaggaggcgatcactgagtgacctgtcagatgaa
gagctgctcctgccagttgatgactatttagccatgaagagaacggaagaagaaagactg
agacttgaagaagaactggagttaggcttttccgcatcacccccaagcagaagccctcca
cgctttgaactgtcttcccttcgttactcagccgcagatgcccaagtcaccgcagacgaa
tccaagagaagggagctgaaatatgcaacctatcatatcccgtctaaagaagaaaccagt
gcgacttatgccgaactccgacaacgccacgacagggcggtctatagaccaacaaaacaa
aaggagaggattctgtctgagaaagaggatgaagaactcctacgtccggttactacaagc
cagagactctccgaatacaagagtgagcttgagtatatgtcacaggaagaaaagagccga
atgagaagaaggagagaaagagaagtaactgagataatatcaaaggaggaagaagaggaa
atggaaatgatgagacacgttcacagggaaatttcgcctccctcaagattgttaagaaga
agacgttctctttctccaacttacattgaactgatgcgccctgtgtctgaattagttcga
ccccgctcacaccctgtggaagaacctgagagaaggtcacctacgccagaaagaactcgg
ccacgctcaccaagtccagtgtccagtgagagatctctgtctcgatttgaaaggacagca
agatttgatatcttctccagatacgagtctatgaaagctgctttgaaaactcaaaaaaca
atggaaaggaaatacgaagttctgactcaagaacctttcaccctggatcatgccccacgc
atcactctaagaatgcgctcccatcgtgtaccgtgtggcaccaacacaagattcattttg
aatgtccagtccaaaccaactgctgatgtgaaatggtatcataacggtattgaaatccaa
gaaagccataagatacatttcactaatactagtggtgtactaaccttggagatcctcgac
tgccatattgatgacagtggtacataccgtgttgtgtgcacaaactataaaggagaatgt
tctgactatgccaccttagaagttacgggaggagagtacacaacatatacctccagacgt
agagatgaggaagtactcagatccgttattcctgacttgacaaggactgaggcgtatgca
gtctcctcatttaagaaagtctctgcaacagaagccagttcttccgtaagagaagtcaag
tcagaactgacagaaacaagagaatcgttgtcatcctatgaacatcacgcttctgctgag
aagaaagtcagtgcctcagaggaaaggtcacttgaagaaagagctacacgccacaagttt
aaaactaccctgctggctaaaatattaacaaaaccacggtcaatcactgtttctgaagga
gagacggcaaggtttacctgcgacaccgatggtgagcccacacccacagtgacgtggatg
cgtgcagggcaaatggttgtttcctctgggcgctaccaagtgacacgtacacagtataaa
tctacctttgagatttcatctgtccagagctcggatgaaggaagttacacggttgtggta
gaaaattcagaaggcagggaggaagcccgcttcagcttgactgtacaaagaaaaagggtt
ccagaaaaagcaatcacatcacccccaagagtcaaatctcccgagccgcgcgtgaagtcc
ccagacagagtgaaatctcccaagcgggtaaagtcccctgaaccatctcctgccccttcc
aaagctaaatcgacaactgcagggaagacaccgccggcagagaccgcagacttgcaagtc
attgctcctcctaagataaaacagcaactgaagctggaagcttctagtgataaaataaag
ctattctgttcagttgaaagcagtgttttaagtgtccgagaagtcgcctggtacaaagat
gggaagaaattaaaagaagacgggcacttcagatttcattacgcagctgatggaacatat
gagcttaagatccatgacctcaaggaatctgaccaaggggaatatacgtgtgagattctt
ggagaaggtggcacctcaaaaaccaattttcagtttgttggccaaacttttaaaagtgca
tactctcaggtatcgagcttgaccaaaactcaaaaagcggaaacagttgaagtatctacc
cagaaaaagtctgcagtgacttcccaagaaaaggttgtggtccaagaggaatctgttaaa
aagtctctggcttcggaagacattaaaaaatcttatgctgaagttaaatctactaccact
aaagagagtgtgactgaaggtcaacgggctacccttaaagccagtattcctggtgcttct
gatgtaaaatggctgctgaatggaattgtgctaactaactctgaagactatcgatatggt
gtgtcaggaactgatcatactctgactatcaaaaaagttacccgtcgtgatgaaggaata
cttacctgtgaaggaaagactgagcagggcattgtcaaatgccacttcgaaatgagtatc
tcagaagaccgttcaaaggtcccagcctttgtaacacagcctagatctcaaaacattgat
gaaggacaagatgtgttgcttacctgtgaggtctctggagacccttctcctgaaatcgag
tggtttaaggataaccaaccaattgctctcacatccaacatccgaataaatcgttccaag
aatgtttattctctatcgattaataatgctgcagtgagtgacagtggaaaatacacagta
aaagcaaaaaattaccacgggcagtgctctgcaacagcatccttgacagtcctacctcta
attgaagaacctccaagagaggtagtgttgaggacaagtggtgatgcaagcatgcaggaa
ggtttctcttcgcagtcatttcaaatgtccgcttctaaacaagaagcttcgttcagcagt
agccgcatgagtgaaatgaaatttgaaagcatgtctgccaaaagcatgtcctccatgaaa
gaatcctttgtagagatgagttccaccagtgtaatggggaaatctagtctgacccaactg
gagagttcaactagtagaatgattaaatcgggtttgagaggaataccacccaaaattgaa
gctcttccaaacgacatctccattgaggaaggaaaggttctcactgtgtcctgtgccttc
tctggggaacctgctcccgaaataagatggtcctgtaaaggcagagacatttccagtcag
gctggtagattccatgttgaaaccagtgaagatttaaccacgcttatcatcatggatgtt
caaaagaatgacgggggactttacacactggatttagaaaatgagtttggcaccgactct
gccactgtgaatattaatattcgatcaatttag

DBGET integrated database retrieval system