KEGG   Pogona vitticeps (central bearded dragon): 110084768Help
Entry
110084768         CDS       T05000                                 

Gene name
ZDHHC23
Definition
(RefSeq) palmitoyltransferase ZDHHC23 isoform X1
  KO
K18932  palmitoyltransferase [EC:2.3.1.225]
Organism
pvt  Pogona vitticeps (central bearded dragon)
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    110084768 (ZDHHC23)
Enzymes [BR:pvt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     110084768 (ZDHHC23)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC
Motif
Other DBs
NCBI-GeneID: 110084768
NCBI-ProteinID: XP_020660052
Position
Unknown
AA seq 482 aa AA seqDB search
MSLPAGVSHFPCNAAEVGPLIPHSSIASVCVCVCVFLPCCCPAGETGWGDRMKPGGTKTS
RSPEMEDTLCCCEYLDRNGQRSHLAACCCECDDLDECCERWLTCKSLPPGILERIADTFT
DRFRLPWLRGAVKIDISLLPPIILLPVFLHVAALHFLLALVILISLPVLVLWYYYLTHRK
KGQTLFFLSLGLFSLGYMYYIFLQEVVPRGQVELSQVILLTCGLILMLVALSQAKRDPGY
LLCQMSSDKALCQGSSSNNNNNKLNRNGLGNSNGLYREPVSGVAMNSNTEGYPRMLAEGP
GRVTEDWCTKCQLVRPARAGHCRICGRCVKRLDHHCVWINTCVGEENHQAFVLTLTLFLI
TSVYGISLTLDTLCKGKSTIKALFYCPGVYGDYSSALSFTCVWYCVIVTSGMGYILLIQL
FNISYNVTEREARIALRENTGRRLLWGLVVDTGQYNRGFLCNWVHFLTLHSSAVQHSSED
IV
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgtccctgcccgctggggtttcccattttccgtgcaatgccgcagaagtgggaccccta
ataccccactcttccattgcctccgtgtgtgtgtgtgtatgtgtgtttctgccttgctgt
tgccccgcgggggagacgggttggggagacaggatgaagccgggagggacgaagacctct
cgaagccccgagatggaggacaccctctgttgctgcgagtacctggaccgcaacgggcag
aggagccacctggcggcctgttgctgcgagtgcgacgacctcgacgagtgctgtgaaagg
tggctgacttgcaaatctttgcccccgggaatattagagagaattgcagacaccttcacg
gaccgctttcgcctcccatggcttaggggggctgtaaagatcgatatcagcctccttcca
ccaatcatcctgctgcctgttttccttcacgtagcagccttgcacttcctcttggctctt
gtcatcttgatatcacttcctgtactggtgctgtggtattactaccttacgcacaggaag
aagggtcaaactctgttcttcttgagtttgggactgttctccctaggctacatgtactac
attttcctccaggaagtggttccccggggccaggtggaactcagccaggtgattcttctc
acctgtggcttaatcctcatgcttgtggccctgtctcaagccaagagagaccctggctat
cttctgtgccaaatgagcagtgacaaagcactttgccaaggcagcagcagcaataataac
aacaacaaattaaacagaaatggcctgggaaattccaatgggctttacagagaacctgtc
tctggcgttgctatgaacagtaacacggagggctatcccagaatgttggcagaggggcca
ggtagggtcacagaggactggtgcaccaagtgccagttggttaggccagctcgagctggg
cactgccggatatgtggcaggtgtgtgaagagactggatcatcactgtgtctggattaac
acctgtgttggggaggagaaccaccaagcttttgttcttacactcaccctttttctgatc
acctcagtatatgggatttctttgacgctggacacactgtgtaaaggaaaatcaaccatc
aaagcactgttctactgtcctggcgtatatggagactacagttctgccctatcattcacc
tgcgtgtggtactgtgttattgtgacctctggcatgggctacatccttctcatccagctc
ttcaacatcagctacaatgtgaccgagagggaagctcggattgctttgcgggagaacacg
gggcgaaggctgttatggggcctggtagtcgacacaggccaatacaataggggcttcctg
tgcaactgggtccattttttgaccttgcactcatctgctgtacagcactccagtgaggac
attgtgtga

DBGET integrated database retrieval system