KEGG   Pogona vitticeps (central bearded dragon): 110085143Help
Entry
110085143         CDS       T05000                                 

Definition
(RefSeq) NADPH--cytochrome P450 reductase isoform X1
  KO
K00327  NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
pvt  Pogona vitticeps (central bearded dragon)
Brite
Enzymes [BR:pvt01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     110085143
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_1 Flavodoxin_1 NAD_binding_1 B UPF0181
Motif
Other DBs
NCBI-GeneID: 110085143
NCBI-ProteinID: XP_020660663
Position
Unknown
AA seq 678 aa AA seqDB search
MGSASSKDDTPSPQTPEASAAFSLTDIFLFSIIIGLLTYWFFFRKKKEEVPEFAKIQTPT
TGVSTSEGSFIEKMKKTGRNIVVFYGSQTGTAEEFANRLAKDAHRYGMRGMSADPEEYDL
SDLSRLSEIDKSLAVFCMATYGEGDPTDNAQDFYDWLQETDADLSGIKFAVFGLGNKTYE
HFNAMGKYVDKRLEELGAQRIFELGLGDDDGNLEEDFITWREQFWPAVCEHFGVEATGDE
SSIRQYELVVHTDLNANKVYTGEMGRLKSYENQKPPFDAKNPFLAQVTKNRKLNQGGERH
LMHLELDIASSKIRYESGDHVAVYPANDTSLVNQLGEILGADLDTIFSLNNLDEESNKKH
PFPCPTSYRVALTYYLDITNPPRTNVLYELAQYATDANEQEHLRKMASSSAEGKALYLSW
VVEARRNILAILQDTPSLRPPIDHLCELLPRLQARYYSIASSSKVHPNAVHICAVVVEYT
TKTGRVNKGVATTWLKNKEPHENGHKSMVPMYVRKSQFRLPFKSSTPVLMVGPGTGIAPF
VGFIQERGWLKQQGKEVGDTVLYYGCRHANEDYLYKDELAQFLKEGALTQLNVAFSRDQP
EKIYVQHLLKKNKANVWKLIHEENGHIYVCGDARNMARDVQNAFYEIVAEFGNMSQQQAV
EYVKKLMTKGRYSLDVWS
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atggggtctgcctcgtccaaggatgacaccccctccccccaaaccccggaggcttcagcc
gccttcagcctgaccgacatcttccttttttccatcatcatcggcctcctgacgtattgg
tttttcttccgcaagaagaaagaggaggtcccggagtttgccaaaatccagacaccaaca
acaggggtgtcgacaagcgaaggcagcttcattgaaaaaatgaagaagacgggaagaaat
attgtcgtgttctacggatctcagactgggaccgctgaagagttcgccaaccgtcttgcc
aaggacgcccaccgttatgggatgcggggtatgtcagctgaccccgaagagtatgatctg
tctgacctgagtcgcctttcggagatcgacaagtccctggcggtgttttgcatggccaca
tatggagaaggggaccccacggacaatgctcaggatttctacgactggctgcaggaaacc
gatgctgacctctctggcattaaattcgcagtctttggcctcgggaacaaaacttacgag
cacttcaacgcgatggggaagtacgtagacaagcggctggaggagctgggcgcccagcgg
atcttcgaacttggccttggggatgacgacgggaacctggaagaagacttcatcacatgg
cgtgagcagttctggccggcggtgtgcgaacacttcggagtggaagccacaggggacgaa
tcaagcatacgccagtacgagctggttgtccacacggacctcaatgcaaacaaggtctac
acgggagaaatgggccggctcaagagctacgagaatcagaaaccaccgtttgatgccaag
aaccccttcttggcccaagttaccaagaaccggaagctcaaccagggcggagagcggcac
ctgatgcaccttgaactggacatcgccagctccaaaatcaggtacgagtcaggagaccac
gtggccgtctacccagccaacgacacttctctggtcaaccagctgggtgaaatcctgggc
gctgatctggatacgatcttctccttgaacaatctggatgaggaatccaacaagaagcac
cctttcccgtgccccacctcgtaccgtgtggccctgacctattatttggacatcacgaac
ccgccacgcaccaacgtactctatgaactggctcagtacgccacggacgccaacgagcag
gagcacctccgcaagatggcctcttcctcggccgaagggaaggctctgtacctgagctgg
gttgtggaggcccgaaggaacatcctcgccatcctccaggatacgccctccctgcggcct
ccgatcgaccacctctgtgagctcctccctcgcctccaggcgcgctactactccatcgct
tcatcgtctaaggtccatcccaacgccgtccacatctgtgccgttgtggtggagtacaca
accaaaacaggccgggtcaacaaaggggtggccaccacctggctgaagaacaaggagccc
cacgagaacggccacaagtccatggtccccatgtacgtccggaagtctcagttccggctg
ccattcaaatccagcacgcccgtcctcatggtcgggcctggcacggggatcgcgcccttc
gtgggcttcatccaggagcggggctggctgaagcagcagggcaaggaggtgggagacacg
gtgctgtactacggttgccggcacgcaaacgaggactacctctacaaggacgaattagcg
caatttctcaaggaaggcgccctgactcagctcaacgtggccttctcgagggaccagccg
gagaagatttacgtccagcacctgctgaagaaaaacaaggccaacgtttggaagctgatc
catgaagaaaacgggcacatctatgtctgtggcgatgcacgcaacatggcccgggatgtc
cagaacgccttctatgagattgtggccgagttcgggaacatgagccagcagcaggcggtg
gaatatgtgaagaagctgatgaccaagggccgttactccctggatgtctggagttaa

DBGET integrated database retrieval system