KEGG   Pogona vitticeps (central bearded dragon): 110085535
Entry
110085535         CDS       T05000                                 

Gene name
MECOM
Definition
(RefSeq) MDS1 and EVI1 complex locus protein EVI1 isoform X1
  KO
K04462  ecotropic virus integration site 1 protein
Organism
pvt  Pogona vitticeps (central bearded dragon)
Pathway
pvt04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110085535 (MECOM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pvt03000]
    110085535 (MECOM)
Transcription factors [BR:pvt03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    110085535 (MECOM)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_jaz zf-C2H2_6 zf-H2C2_5 zf-C2H2_11 zf-BED Zn-ribbon_8 zf-C2H2_8 zf-met PyrI_C zinc_ribbon_15
Other DBs
NCBI-GeneID: 110085535
NCBI-ProteinID: XP_020661465
Position
Unknown
AA seq 1078 aa
MKTDEYLHETMAPDIHEERQYRCEDCDQLFESKAELVDHQKFPCSTPHSAFSMLDEEFQP
KLDKENELHDLHDIQECKECDQVFSDVQSLEKHMLSHTEEREYKCDQCPKAFNWKSNLIR
HQMSHDSGKHYECENCAKVFTDPSNLQRHIRSQHVGARAHACPECGKTFATSSGLKQHKH
IHSSVKPFICEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFSTTSSLNKHRRFCE
GKNHFAAGGFFGQGISLPGTPAMDKSSMVNMNHANPGLADYFGANRHPAGLTFPTAPGFS
FSFPGLFPSGLYHRPPLIPASSPVKGLPSTDQTIKSQSPLMTHPQTLPATQDILKALNKH
SPNVNENKPVELQPERSSEERPHEKVSDQSESSDLDDVSTPSGSDLETTSGSDLESDIES
DKEKCKENGKMFKDKVNSLQNLASVNNKKEYSNHSIFSPSLEEQTAVSGAVNDSIKAIAS
IAEKYFGSTGLVGLQDKKVGALPYPSMFPLPFFPAFSQSMYPFPDRDLRPLPLKMEPQSP
GEAKKISKGNSESPFDLTTKRKEEKPLTPITSKPAAPSLTSQDQPLDLSMGSRSRASGTK
QSEPRKNHIFGGKKSDLDHESRKSSDISLQHARPTPFFMDPIYRNVDLHCNQRCFTQELK
TRCTIATQRGTQGVEKRKLTDPLEALKEKYLRPSPGFLFHPQFQLPDQRTWMSAIENMAE
KLESFSALKPEASDLIQSVPSMFNFRAPPSTLPENLLRKGKERYTCRYCGKIFPRSANLT
RHLRTHTGEQPYRCKYCDRSFSISSNLQRHVRNIHNKEKPFKCHLCDRCFGQQTNLDRHL
KKHENGNVSGTATSSPHSELESTGAILDDKEDSYFTEIRNFIGNSNHNNSEERMNGSHLK
DEKTLVASQNSDLLDDEEAEDEVLMDEEDEESEITGKPVKELATSNICEEATEGSYEEAN
TLEMNCKSTPGRYKEDEFDKTGLSALDHIRHFTDSLKVRKIEESQFSEAELAAFTTSHLP
EDLKPPLHRKSKSQAYAMMLSLSDKDSLHSASHNSSNMWHNIARAAAESGAIQSISHV
NT seq 3237 nt   +upstreamnt  +downstreamnt
atgaagactgacgaatatttacatgaaacaatggctccagatattcacgaggagcgtcag
tatcgctgtgaagactgtgaccagctgtttgaatccaaagcagaactggtagaccatcag
aaatttccatgcagtacacctcattcagctttttcaatgctggatgaagaatttcagcca
aagcttgacaaagagaatgaactccacgatttgcatgacattcaagagtgcaaagaatgt
gatcaagtgttctcagatgtgcagagcttagaaaagcacatgctctctcacactgaagag
agggagtacaagtgtgaccaatgtccaaaggcctttaactggaaatccaacttgatacgc
catcagatgtcacatgacagtgggaagcactatgaatgcgaaaactgtgccaaggttttc
acggaccccagcaacctccagaggcatattcgctcacagcatgttggggctcgtgcacat
gcttgtccagagtgtggtaaaacttttgctacgtcttcaggcctcaaacagcacaaacat
atccacagcagtgtcaagccttttatatgtgaggtctgccataaatcctatactcagttt
tcaaacctttgccgtcataagcgtatgcatgctgattgcagaactcaaatcaagtgcaaa
gactgtggacaaatgttcagcactacgtcttccttaaataaacacaggagattttgtgag
ggcaagaaccattttgcggcaggaggattttttggccaaggcatatcacttcctggaacc
ccagctatggataaatcttccatggttaatatgaatcatgcaaatccgggccttgctgat
tattttggtgccaataggcatcctgctggtcttacctttccaacagctcctggattttct
tttagcttccctggcttgtttccttcaggcttgtaccacaggccacctttgatacctgct
agttctcctgttaaaggacttccaagcacagaccaaacaatcaaaagtcaaagtcccctc
atgacacatcctcagacactgccagctacccaggatattttgaaggcactaaataagcac
tcacctaacgtaaatgaaaataagccagtggagcttcaaccagagaggtcctctgaagag
aggccacatgaaaaggtcagtgaccagtcagagagtagtgaccttgatgatgtcagtacc
cccagtgggagtgacctggagaccacctctggctctgatctggaaagtgacattgaaagt
gataaagagaaatgtaaagaaaatggtaaaatgttcaaagacaaagtaaactctcttcag
aatttggcttccgtaaataataagaaagaatacagcaatcattccatcttctcaccatct
ttagaggagcaaactgcggtgtcaggagctgtgaatgattctataaaggccattgcctct
attgctgagaaatactttggttcgacaggacttgtggggctacaagacaaaaaagttgga
gccttaccttacccttccatgtttcccctcccattttttccagcattctctcagtcaatg
tacccatttcctgatagagacttgagaccgttacctttgaaaatggaaccccaatcacca
ggagaagcaaagaagatctcaaagggaaactctgagtctccctttgaccttaccactaaa
cgtaaagaggagaaaccacttactcctataacttcaaaaccagcagctccatcattgacc
agccaagaccagcctcttgatttgagcatgggcagcagaagtcgagctagtggtacaaaa
cagagtgaacctcgaaaaaaccacatctttggaggaaagaaaagcgatctcgatcatgaa
tcaaggaaatcatcagacatctctttacaacatgcaaggccaacgcctttctttatggat
cccatttacaggaacgtcgatctccactgcaatcaaaggtgtttcactcaagaactcaaa
acacgttgtaccatagcaacacaacgtggaactcaaggagtagagaaaagaaagttaact
gacccacttgaagctttaaaagaaaagtacttgagaccatccccgggattcttattccac
ccacaattccaattgcctgatcaaagaacttggatgtcagctatagaaaacatggctgaa
aagttagagagttttagtgctctgaaaccagaagccagtgacctcatacaatctgtccct
tccatgttcaacttcagagcccctcccagcaccttgccagagaatcttctgcgaaaaggc
aaagaacgttatacctgcaggtactgtggcaagatttttccaagatctgcaaatcttacc
cgtcacctgaggacgcacactggggagcagccttacagatgcaaatactgtgacaggtct
ttcagcatatcatctaatctgcaaagacatgttcgtaacatccacaataaggagaagcct
ttcaaatgtcatttatgtgacaggtgctttggccaacaaaccaatttagacagacatctc
aaaaaacatgaaaatggcaatgtgtctggtactgctacatcttcacctcactctgaactt
gaaagcacgggcgctatcttagatgacaaagaggactcatacttcacagaaatccgaaat
tttatcgggaatagtaatcacaacaattcagaagaaagaatgaatggaagtcaccttaag
gatgaaaagactttggtagcaagccaaaactcagacttgttggacgatgaggaagcagaa
gacgaagttttgatggatgaagaagatgaagaaagtgagataacagggaagccagttaag
gaacttgcaacaagcaatatatgtgaagaggctactgagggcagttatgaagaagcaaac
acattggaaatgaattgcaaatctactcctggcaggtataaggaagacgagtttgataaa
actggactctctgctttggaccacataaggcacttcacggatagtctcaaagtgaggaaa
atagaagaaagccagttcagtgaggccgaactggcagcattcaccacctctcatttgcca
gaagacttaaaaccaccattgcatcgcaaatccaaatcccaggcctacgctatgatgctc
tcgctctctgacaaggactctctccactctgcatcccacaactcctccaatatgtggcac
aatatagcaagagctgctgcagaatctggtgccatccagtccattagtcatgtatga

DBGET integrated database retrieval system