KEGG   Pogona vitticeps (central bearded dragon): 110085766
Entry
110085766         CDS       T05000                                 

Gene name
AHRR
Definition
(RefSeq) aryl hydrocarbon receptor repressor isoform X1
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
pvt  Pogona vitticeps (central bearded dragon)
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pvt03000]
    110085766 (AHRR)
Transcription factors [BR:pvt03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    110085766 (AHRR)
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_11 PAS_9
Other DBs
NCBI-GeneID: 110085766
NCBI-ProteinID: XP_020661887
Position
Unknown
AA seq 727 aa
MIPPGECLYAGRKRRKPIQKQRPALVNGKSNPSKRHRDRLNAELDHLASLLPFPPDVISK
LDKLSVLRLSVSYFRVKSFFQALQEKHPRKQTNDGIKEISLLKEPAIPEGGFLLESLSGF
ALIVSGDGMIFYASPTIVDYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMNPPQLMP
GGHEHAATGEEFILSKMCTAQEGDNIADFSPFLTRCFTCRIRCLLDSTSGFLTMHFQGKL
KFLFGQKRKSSSGAILPPQLSLFCIVVPLLLPSVTDVKLKSLFVKTRCKSDHTAATDINS
KSISAQYMADFHRRNTFQEGENNRENGISLVKLQANKDHWVWIQANTQVQYRDGSSEYAI
ALQQTPREDRIPKIPNSIATMKRNRETLGQKKHSKWSSRKKEQDNIKVKFERNSNNEEFF
IQQEFVNPAVSLLGVQHNNNGHGMWTSRNPPSSCSRSQHNENMYSNKTLRPRYNRDQQLF
GLSSTCSSPWGGIESCHPYPSLQQFTLDSYSGEYMKVQCPPVSPETLYNTHNMPIKTEYD
SDSENIASSYTISPSQVWMDENYTMKKQSMEFSSRVHLKTELDLGEQFFPCQTPKHCVYS
PYNWQHVVMHHTNNLNRNGVGKVVRNKEATSLSPQKPICIETTQREPASYYCNQFYSANL
IDERGLNGQVLKTHSEFKNPKIVQSVKHEPLDPPFVSDNGQDGVQTSLHETALASFHPHK
IMRQQSV
NT seq 2184 nt   +upstreamnt  +downstreamnt
atgattccaccaggagaatgcctatatgctggcaggaaaagacggaaacccattcagaaa
cagaggcctgcgcttgtgaatggaaagtctaatccatcaaaacgacatagagaccgcttg
aatgctgaacttgaccacctggccagcctcttgcctttcccaccagatgtaatctctaaa
ctggacaaactctctgtcttacggctcagtgtcagttactttagagtaaaaagtttcttt
caagctcttcaagagaagcacccgagaaagcaaacaaatgatggaataaaagaaattagc
ttactcaaggaacctgcaattcctgaaggtggattcttattagagtcattgagtggcttt
gctctgatagtgagtggtgatgggatgatattctacgcatcaccaacaattgtggactac
ctaggatttcaccagactgatgtaatgcatcaaaatatatatgattatattcatgtggat
gatcggcaggatttctgcaggcaactacactgggccatgaatccaccacaactaatgcct
ggaggacatgagcatgcagcaacaggagaagaatttattcttagtaaaatgtgtacagcg
caagagggtgacaacatagcagacttttcaccatttttaactcgttgttttacctgtcga
atccgctgccttctagacagtacttctggctttcttaccatgcatttccagggtaaactg
aaatttctctttgggcagaaaaggaaatcatcctcaggagctattttaccccctcagctc
tctttattctgcatagtggtaccacttctgcttccttctgtgactgatgtgaagttaaaa
agcctttttgtgaaaacaagatgcaaatctgatcacacagctgcaacagatataaactca
aagtccatttctgcacagtatatggcagattttcatagaagaaatacttttcaagaagga
gagaataatagggaaaatggcatttccttagtgaagctgcaagcgaacaaagaccactgg
gtttggatacaggcgaatactcaggttcagtatagagatggttcttcagaatatgccatt
gctcttcagcaaactcccagggaagatagaattccaaagataccaaacagcattgcaacc
atgaaaaggaacagggaaacattgggacagaagaaacatagtaagtggagctcaaggaag
aaagagcaggataatataaaagtgaaatttgaacgcaattcaaataatgaggaatttttc
attcagcaagaatttgttaatcctgctgtctcattgcttggtgtccagcacaataacaat
ggacatggcatgtggacttcaagaaatcctccaagttcttgttctagaagccagcacaac
gagaacatgtattcaaacaaaactttaagacctcgctacaatagagatcagcagctcttt
ggtttgtcatcaacctgttcttccccctggggtggcatagaaagttgccatccttatcca
agcttgcagcaattcacactagacagttactcaggagaatatatgaaggtacaatgccca
ccagtatccccagaaactctgtacaacactcataacatgccgatcaaaacagaatatgat
tcagattctgaaaacatagctagtagttataccatttcaccaagtcaggtttggatggat
gaaaactacacaatgaaaaagcagtcaatggaattttcttctagggtccaccttaaaaca
gaactagacctcggcgagcaattcttcccttgccaaaccccaaagcattgtgtctactca
ccatataactggcaacacgtagtaatgcatcataccaataacctcaatagaaatggagtt
ggcaaagttgtgcgtaataaggaggcaacttctttgagccctcaaaagcccatctgtata
gaaacaacacagagagagccagcttcatattactgcaatcagttttatagtgcaaatttg
attgatgagagggggctgaacggccaggttctgaagacacactctgaatttaaaaatccc
aagattgttcaatcggttaaacatgaacctttggaccctccttttgtatctgacaatggt
caggatggagtacagacttctctccatgaaactgcattagcaagttttcatcctcataag
ataatgcggcagcaaagtgtataa

DBGET integrated database retrieval system