KEGG   Pogona vitticeps (central bearded dragon): 110086662Help
Entry
110086662         CDS       T05000                                 

Gene name
DOCK7
Definition
(RefSeq) dedicator of cytokinesis protein 7 isoform X1
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
pvt  Pogona vitticeps (central bearded dragon)
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pvt04131]
    110086662 (DOCK7)
Membrane trafficking [BR:pvt04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    110086662 (DOCK7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N
Motif
Other DBs
NCBI-GeneID: 110086662
NCBI-ProteinID: XP_020663403
Position
Unknown
AA seq 2134 aa AA seqDB search
MAERRAFAQKISRTVAAEVRKQISGQYGGSPQLLKNLNIGGNISHHTTVPLTEPVDPVDM
EDYLLTHPLAVESGPLRDLLEFPSDDIEVIYSPRECRTLVLSVPEESEMDPHVRDCVRSY
TEDWAIVNRKYHKLGTGFNPNTLDKQKERQKGLPKQVFESDETPDGNSYQDEQDDLKRRS
MSIDDTPRGSWACSIFDLKNSLPDALLPNLLDRTPNEEIDHQNDDQRKSNRHKELFALHP
APDEEEPIERLSIPEIPKEHFGQRLLVKCLSLKFEIEIEPIFASLALYDVKEKKKISENF
YFDLNSEQMKSMLRPHVPPAAISTLARSAIFSITYPSQDVFLVIKLEKVLQQGDIGECAE
PYMILKEADTAKNKEKLEKLKSQSEQFCQRLGKYRMPFAWTAIHLMNIVSSAGSLERDSA
EVEIATGERKGSWSERRNSSIVGRRSLERTTSGDETCNLTNFRPATLTVTNFFKQEGDRL
SDEDLYKFLADMRRPSSVLRRLRPITAQLKIDISPAPENPQYCLTPELLQVKLYPDSRVR
PTKEILEFPSRDVYVPNTTYRNLLHVYPQSLNFANRQGSARNITVKVQFMFGEDPSNAMP
VIFGKSSCAEFSKEAYTAVVYHNRSPDFHEEIKIKLPATLTDHHHLLFTFYHVSCQQKQN
TPLETPVGYTWIPMLQNGRLKTGQFCLPVSLEKPPQAYSVLSPEVPLPGMKWVDNHKGVF
NVEIVAVSTVHTQDPYLDKFFALVHALDEHMFPVRIGDMRIMENNLENELKGSISALNSS
QLEPVVRFLHLLLDKLILLVVRPPIIAGQIVNLGQASFEAMASIVNRLHKNLDGNQDQHG
RNNLLTSYIYYVFRLPNTSSNSPSPGPGGLGGSVHYATMARSAVRPASLNLNRSRSLSNS
NPDISGTPTSPDDEVRSIIGSKGLDRSNSWVNTGAPKAAPWGSNPSPSAETTQATDRSCN
RMSSHTETSSFLQTLTGRLPTKKLFHVELALQWVVCSGSVREAALQQAWFFFELMVKSMI
HHLYFADKLDASRKNRFPERFMDDIAALVSTIASDIVSRFQKDTEMIERLNTSLAFFLND
LLSIMDRGFVFLLIKAYYKQVSSKLYSLPNPSTLVSLRLDFLRIVCSHEHYVTLNLPCSL
LTPPASPSPSVSSATSQSSGFSTNVQDQKIANMFELSVPFRQQHYLAGLVLTELAVILDP
DADGLFGLHKKVINMVHNLLSSHDSDPRYSDPQVKARVAMLYLPLIGVIMESVPQLYDFT
ESHNQRGRPSCTSTEDYESEGGNMISQTVAMAIAGTSVPQLTRPSSFLLTTSTNRQHSTF
SAESSRNLLICLLWVLKNADESILQKWFTDLSVLQLNRLLDLLYLCVSCFEYKGKKVFER
MNSLTFKKSKDMRAKLEEAILGSIGARQEMVRRSRGQLERSPSGSAFGSQENLRWRKDMT
HWRQNTEKLDKSRAEIEHEALIDGNLATEANLIILDTLEIIVQTVSVTESKESILGGVLK
VLLHSMACNQSALYLQHCFATQRALVSKFPELLFEEETEQCADLCLRLLRHCSSSISTIR
SHASASLYLLMRQNFEIGNNFARVKMQVTMSLSSLVGTSQNFNEEFLRRSLKTILTYAEE
DLELRETTFPDQVQDLVFNLHMILSDTVKMKEHQEDPEMLIDLMYRIAKGYQNSPDLRLT
WLQNMAGKHSERSNHAESAQCLVHSAALVAEYLSMLEDRKYLPVGCVTFQNISSNVLEES
AVSDDVVSPDEEGICSGKYFTEAGLVGLLEQAAASFSMAGMYEAVNEVYKILIPIHEANR
DAKKLATIHGKLQEAFSKIVHQSTGWEDGKRMFGTYFRVGFYGTKFGDLDEQEFVYKEPA
ITKLAEISHRLEGFYGERFGEDVVEVIKDSNPVDKCKLDANKAYIQITYVEPYFDTYEMK
DRITYFDKNYNLRRFMYCTPFTLDGRAHGELHEQFKRKTILTTSHAFPYIKTRINVIHKE
EIILTPIEVAIEDMQKKTQELAFATHQDPADPKMLQMVLQGSVGTTVNQGPLEVAQVFLS
EIPNDPKLFRHHNKLRLCFKDFTKRCEDALRKNKSLIGPDQKEYQRELERNYHRLKEALQ
PLINRKIPQLYKAVLPAACHRDSFSRMSLRKIDI
NT seq 6405 nt NT seq  +upstreamnt  +downstreamnt
atggccgagcgccgcgccttcgcccagaagatcagcagaacagtagcagctgaagttcgg
aaacagatttcaggacaatatggaggatcaccacagctcctcaagaaccttaatattgga
ggcaatatttcccatcacacaactgtgcctcttactgagccagtggatccggtggatatg
gaagattaccttcttactcatccacttgcagtggaatccggtcctttgagagacttgctt
gaatttccttcagatgatattgaagttatctatagtccacgggaatgcaggacacttgta
ttatctgtacctgaagaaagtgaaatggatcctcatgtaagggattgtgtgagaagctac
acagaggactgggccattgtgaacagaaagtatcacaaactgggaacaggatttaacccc
aacacattagacaagcagaaggaaaggcaaaaaggcctgcccaaacaggtcttcgagtct
gatgaaacaccggatggaaacagttaccaggatgagcaagatgaccttaaaagacgctcc
atgtccatagatgatacaccacggggcagctgggcttgcagcatttttgacctgaaaaac
tccctcccagacgctttgcttccaaatcttctggatcgtaccccaaatgaagaaatagac
catcagaatgatgatcagcggaagtccaacagacacaaggagctgtttgcattgcatcca
gcccctgatgaggaagaaccaatagaaaggctgagcatccctgaaatccccaaagaacat
tttggccagaggctgcttgtgaagtgtttgtctttaaaatttgaaattgaaattgagcca
atttttgccagtttggcattgtatgatgttaaggaaaagaaaaagatttcagagaatttc
tactttgatttgaattctgagcaaatgaaaagcatgttacgtcctcatgtcccacctgct
gccatatccacattggcccggtcagccatcttttctataacatacccgtcacaagacgtc
ttcctcgtaattaagctggaaaaggtattgcagcagggagatattggggagtgtgcagag
ccgtatatgattttaaaagaagcagatactgcaaagaataaagagaagctggaaaaacta
aaaagccaatccgagcagttttgccaaagacttggaaaataccgcatgccttttgcatgg
acagccattcatttaatgaatatagtcagcagtgctggaagtttggagagggactctgca
gaagtggagattgccacgggagaacgcaaaggatcttggtcagagaggagaaattctagc
atcgttggcaggcgttccttggaaagaaccaccagtggggatgagacttgcaacttgact
aactttaggccggctaccctaacagtgacaaacttctttaaacaggaaggtgaccgtctg
agtgatgaagacctgtacaagtttcttgcagatatgagaaggccgtcttctgttctgcgg
aggctaaggcctatcacagctcagctgaagatagacatttctccagctccagagaaccca
cagtactgtttaactccagagctgctacaagtgaaactttaccctgacagcagagtacga
ccaacaaaagagattctggagtttccttcaagggatgtttatgttccaaatacaacatac
agaaatctactacatgtctatcctcaaagcctcaactttgccaaccgtcaaggttctgct
cggaacatcactgtaaaagtccagtttatgtttggagaagatccaagtaatgcaatgccg
gtaatctttggtaaatcaagctgtgctgagttttcgaaagaggcgtacacagctgttgtt
tatcataacaggtctcccgattttcatgaagagattaagatcaaactccctgcaacgtta
acggaccatcaccacctgctttttacattttatcatgtcagttgccaacagaagcaaaac
actcctcttgagactcctgtcggatacacgtggataccaatgctccagaatggacgattg
aagactggtcagttctgcctccctgtttccctggaaaagccaccacaggcttattcagtg
ctctcaccagaggtgcccctgccaggaatgaaatgggtagataaccataagggagttttc
aatgtagaaatagttgctgtgtcaaccgttcatacacaggacccttatcttgacaagttc
ttcgctcttgtgcatgcactggatgaacatatgttccctgtgcggataggtgacatgagg
ataatggaaaacaacttggaaaatgaattaaaaggcagcatttcagctttgaattcatct
cagctggagcctgtggtgcgatttctccatctcctgcttgacaaactgatccttttggtt
gtgagacctcctattattgcaggccaaatagtcaatcttggtcaagcatcatttgaagcc
atggcttccattgtaaacagactgcacaaaaacttagatgggaaccaagaccagcatggc
agaaataatcttcttacttcatatatttattatgtctttcgcttaccgaatacctcttcc
aattcaccatcacctggtcctggtggtttgggaggatcagttcattatgcgaccatggct
cgttcagctgtcagaccagcaagcttaaatttaaatcgctccaggagtcttagtaacagc
aacccagatatatctgggacaccaacctcacctgatgatgaagtacggtcaatcattggg
agtaagggcttggatcgctccaattcctgggtaaacactggtgctccaaaagccgcccca
tggggatccaaccccagtccaagtgcagagactacacaggctacagatcgaagttgtaat
cgtatgtcttcgcacacagagacgtcaagtttcttacaaacattaacaggacgattacca
actaaaaagctttttcatgtggaactggccttgcagtgggttgtctgcagcgggagtgta
cgggaggctgctctccagcaagcatggttcttctttgaacttatggtgaaaagtatgata
catcatttgtattttgctgacaaactcgatgcatcaaggaagaatcgttttccagagcgc
ttcatggatgacatagctgctctggtcagcacaatcgccagtgatatagtctcccggttt
cagaaggatacagaaatgattgaaagactcaacactagtttagctttctttctcaatgat
ctgttgtctatcatggacagaggatttgtctttctcctgatcaaggcttactacaaacag
gtgtcatccaagctttattctctaccaaaccccagtactcttgtgtccttgagactggat
ttccttcggattgtctgtagccatgaacactatgtgactctgaatctaccatgcagtctt
ctgacaccccctgcatccccatcaccctcagtgtcctcagccacttctcagagttctgga
ttctcaacaaacgtccaggatcagaagattgcaaacatgtttgaactgtctgtgcctttc
cgccagcagcactatttggcaggcctggtgctaactgagctggctgtcattttagatcct
gatgcagatggtttgtttggattgcataagaaagtcatcaatatggtacacaatttgcta
tctagccatgactccgacccacggtactctgacccgcaggtaaaggccagggtggctatg
ctgtatctgcctttgattggagtaatcatggagagtgtaccccagctgtatgatttcaca
gaaagtcacaatcagcgtggaagaccaagttgtacatcaacagaggattatgaaagtgag
ggagggaacatgataagccaaacggttgccatggctattgcaggaacctctgtcccacag
ctcacccgacccagcagttttctccttacaacatcgaccaacaggcagcactcaacgttt
tcagccgagtcaagtcggaaccttttgatctgtcttttgtgggtcctaaagaatgctgat
gaaagtatcctgcagaagtggttcacagacctctctgtccttcagcttaaccgcttgttg
gatttgctgtatctctgtgtttcctgttttgaatataagggcaagaaagtcttcgaaaga
atgaacagtctgacttttaagaagtccaaagatatgagagcaaagcttgaagaagctata
ctggggagcattggcgcaaggcaagaaatggtacggcgaagcagggggcaactggaaaga
agtccttcggggagtgcgtttggaagccaggagaacctgaggtggagaaaggatatgact
cactggcggcagaacacagaaaaacttgacaaatcacgggcagagattgaacacgaggcc
cttattgatggcaacttggcgactgaagcaaacctgattattctggatacattagagatt
atagttcagacagtctctgtgactgaatccaaggaaagcattcttggcggagtgctgaag
gtgcttttgcatagcatggcctgcaaccagagcgccctttacttgcaacactgctttgca
actcagagggccttggtctcaaagttcccagaacttctttttgaagaagagactgagcag
tgtgctgacttgtgccttcgcctcttgcgccactgtagcagtagcattagcaccatacgc
tctcatgccagtgcctccctctatcttctcatgaggcaaaacttcgagatcgggaacaac
tttgccagagttaaaatgcaggtgacaatgtcactctcatctctagtggggacatctcag
aattttaatgaagagtttctgagacgttctctgaagactatattgacctatgctgaagag
gacctggaactgagggagacgacattccctgatcaggtccaggatcttgtgttcaacctc
catatgatcttgtctgatacggttaaaatgaaagagcaccaggaagatccagaaatgctg
attgacttgatgtacagaattgcaaaaggctaccagaactctccagatctacgattaacc
tggctgcaaaacatggctgggaagcactctgagaggagcaaccatgccgaatctgcacag
tgtttggttcattctgcagcactggttgccgaatacttaagcatgcttgaggatcgaaaa
tatcttcctgtagggtgtgttacatttcagaatatctcctcaaacgttctagaagaatct
gccgtttcagacgatgttgtgtcaccagatgaagaagggatatgctctggaaagtatttt
acagaagcaggactggtgggattgctggagcaagctgcagcgtctttttccatggctggg
atgtatgaagccgtcaacgaggtttacaaaattcttattccgattcatgaagcgaacaga
gatgccaagaaactggctacaattcatggtaaactccaggaagcattcagcaagatcgtt
caccagagtactggctgggaggatggtaagcggatgtttggtacatacttccgtgttggg
ttttatgggactaagtttggagacttggatgaacaagagtttgtttacaaggaacctgca
ataacaaaactggctgaaatttctcatcgattagagggattttatggagaaaggtttggc
gaagatgttgttgaagttattaaagattctaacccagtcgacaaatgtaaattagatgct
aacaaggcttatatacaaataacgtatgtagaaccttattttgacacatatgaaatgaag
gataggataacctattttgacaaaaattacaacctccgacgattcatgtactgtacaccc
ttcacgctggacggcagagctcatggggagctacatgaacagttcaagaggaagacaatc
ttaacaacatcacatgctttcccttacattaaaaccaggataaatgttattcacaaggag
gagataattttgacgccaattgaagttgccattgaggatatgcagaaaaaaacccaagaa
ttggcttttgctacccatcaagatccagcagatcccaagatgctccagatggtgcttcag
ggctcagtaggcactacagtgaatcagggaccactagaggttgcacaggttttcttgtct
gaaatacccaacgatcccaaactgtttcgtcaccataacaagttacggctttgtttcaaa
gacttcacaaaaaggtgtgaagatgccttgcgcaaaaacaaaagcctgattggtccggac
caaaaagaatatcagcgagagcttgaaagaaattaccaccgtctcaaggaagcactgcag
cccctgatcaatagaaaaattccccagttatacaaggctgttcttcctgctgcttgccac
agagattccttcagcaggatgagccttcgcaaaattgacatctaa

DBGET integrated database retrieval system