KEGG   Pogona vitticeps (central bearded dragon): 110086832Help
Entry
110086832         CDS       T05000                                 

Gene name
TGFBR2
Definition
(RefSeq) TGF-beta receptor type-2
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
pvt  Pogona vitticeps (central bearded dragon)
Pathway
pvt04010  MAPK signaling pathway
pvt04060  Cytokine-cytokine receptor interaction
pvt04068  FoxO signaling pathway
pvt04144  Endocytosis
pvt04218  Cellular senescence
pvt04350  TGF-beta signaling pathway
pvt04520  Adherens junction
pvt04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110086832 (TGFBR2)
   04350 TGF-beta signaling pathway
    110086832 (TGFBR2)
   04068 FoxO signaling pathway
    110086832 (TGFBR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110086832 (TGFBR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110086832 (TGFBR2)
  09143 Cell growth and death
   04218 Cellular senescence
    110086832 (TGFBR2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    110086832 (TGFBR2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110086832 (TGFBR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pvt01001]
    110086832 (TGFBR2)
Enzymes [BR:pvt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     110086832 (TGFBR2)
Protein kinases [BR:pvt01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   110086832 (TGFBR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ecTbetaR2 Pkinase_Tyr Pkinase DAG1 Pkinase_fungal APH Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 110086832
NCBI-ProteinID: XP_020663709
Position
Unknown
AA seq 563 aa AA seqDB search
MSGLPKHVLMWILLHSTAPPLAGVTAEDHLSSVFDGQIKLRALCKFCDVKLTSCKNEGRC
KSQCNITSICADENEVCVAVWRRNDKNVTLETICHNPKKKLDGHELDDFNSDKCIMKEKK
EAGGFLFMCSCKMEECNDELIFSEDNSSYSFPSSDIKGVISKVAVISLVPLLVIAVAVTV
IFYCYRIQRARKMNMSWEKKKSRTHKDCSDVCAMILDDNGSDISSTCANNINHNTELLPI
ELDTLVGKGRFAEVYKAKLKQNTSEQFETVAVKIFSYEEYASWKTEKDIFSDINLKHENI
LQFLTAEERKTDLGKQYWLITAFHARGNLQEYLMKHIISWEDLWRLGGSLARGIAHLHSD
HTPCGRPKTPIVHRDLKSSNILVKNDLTCCLCDFGLSLRLDPTLSVDDLANSGQVGTARY
MAPEVLESRMNLDNVESFKQTDVYSMALVLWEMTSRCNGVGEVKEYEPPFGSKVREHPCV
ESMKDNVLRDRGRPEIPNSWLNHQGIQKVCETLVECWDHDPEARLTAQCVAERFNDLEYQ
DRLSGRSSSEEKIPEEVSVNGAN
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgagcgggcttcccaagcacgttttgatgtggatcctcctgcacagcacggctcccccg
ctggctggggtcacagctgaagatcatttatccagtgtatttgatggtcaaatcaaatta
cgggcactttgcaagttttgtgatgttaaattaaccagctgcaaaaatgaaggccgttgc
aagagtcaatgcaatatcacatctatctgtgctgacgagaatgaagtatgtgtagctgtt
tggagaaggaacgataaaaatgtaactttggaaacgatatgtcataatcccaaaaaaaag
ctcgatgggcatgaactggatgatttcaattctgataaatgtataatgaaagagaagaag
gaagctggaggatttctgttcatgtgttcctgcaagatggaagaatgcaatgatgaactc
attttttccgaagacaattcaagttacagcttcccttccagtgacattaaaggtgtgatc
tctaaagttgcagtaataagcctcgtcccattgcttgtgattgccgttgctgttactgtt
atcttttactgttaccggattcagagggcaaggaagatgaacatgtcatgggagaaaaaa
aagtccaggacacataaagattgcagcgatgtttgtgccatgatattggatgataacggc
tctgacattagttcaacttgtgcaaataacattaaccataatactgagctgttgcccatt
gagctggacaccctggtaggcaaaggacggtttgctgaagtctataaggctaaactgaag
caaaacacctcagaacagtttgaaacagtggctgtcaagatcttctcctatgaagaatat
gcctcctggaagactgagaaagacatattctctgacataaacctgaagcatgagaatatt
cttcagttcctaacagctgaggaacgcaagacagatctaggcaagcagtactggttgatc
actgctttccatgcaagaggaaacttgcaggagtaccttatgaaacacatcattagctgg
gaagacctctggcgattgggtggatctttggctcgagggattgcccatcttcatagcgac
catacaccttgtggccgaccaaagacacccattgtccacagagacttaaagagctctaac
atattggtcaaaaatgacttaacgtgttgcctgtgtgactttgggctgtcacttcgactg
gatcctactctttctgtagatgacttggccaacagtgggcaggttggcacagcaaggtac
atggctcctgaagtcttggaatccagaatgaacttagataatgttgaatctttcaagcag
actgatgtgtattccatggctttggttctgtgggaaatgacatctcgctgtaatggtgtt
ggagaggtgaaagaatatgagccgccctttggttctaaagtgcgagaacatccatgtgtt
gaaagtatgaaagacaatgttttaagggacagaggacgaccagaaattcctaactcatgg
cttaaccatcagggcatccagaaagtgtgtgagactctggtcgagtgctgggaccacgac
cctgaggcccggctcacggcgcagtgtgtagccgagcgattcaatgatttggagtaccag
gacagactctcgggaagaagcagttctgaagagaagatccctgaagaggtctctgtgaat
ggagccaactaa

DBGET integrated database retrieval system