KEGG   Pogona vitticeps (central bearded dragon): 110088020Help
Entry
110088020         CDS       T05000                                 

Definition
(RefSeq) L-amino-acid oxidase-like
  KO
K03334  L-amino-acid oxidase [EC:1.4.3.2]
Organism
pvt  Pogona vitticeps (central bearded dragon)
Pathway
pvt00250  Alanine, aspartate and glutamate metabolism
pvt00270  Cysteine and methionine metabolism
pvt00280  Valine, leucine and isoleucine degradation
pvt00350  Tyrosine metabolism
pvt00360  Phenylalanine metabolism
pvt00380  Tryptophan metabolism
pvt00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pvt01100  Metabolic pathways
Module
pvt_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    110088020
   00270 Cysteine and methionine metabolism
    110088020
   00280 Valine, leucine and isoleucine degradation
    110088020
   00350 Tyrosine metabolism
    110088020
   00360 Phenylalanine metabolism
    110088020
   00380 Tryptophan metabolism
    110088020
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    110088020
Enzymes [BR:pvt01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.2  L-amino-acid oxidase
     110088020
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase
Motif
Other DBs
NCBI-GeneID: 110088020
NCBI-ProteinID: XP_020665714
Position
Unknown
AA seq 235 aa AA seqDB search
MRFDEIVGGMDQLPRVIYSTIPGLVHFNARVIRIEQNAHRVNVIYRTPGKTVSSVMADYA
IVTSTTRATRRIYFDPPLSPNKTNALRSTYYRSATKIFLACRQKFWERDGIYGGKSTTDR
PSRFIYYLAQNFTGGVGVILASYVQGDDSRFFLALSDENVVNIIMDDLAAVHQMPKWEIR
NLCPSAVVKQWSLDQYSMCAYTTFTPYQFIDYSETLGMPEGRIHFAGEYTAKLHG
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgcggtttgatgaaattgtgggaggcatggatcagctgcccagagtcatttacagtaca
atcccaggactggttcatttcaatgccagagtcatcaggatagagcagaacgcccacaga
gtcaatgtgatttatcggaccccagggaaaacggtatcaagtgtgatggccgattatgcc
attgtcacctccacaaccagggccacgcgacgcatctattttgatccacctctttcgcct
aacaaaacaaacgccctgaggtccacctactacaggagtgccaccaaaatcttccttgct
tgcagacagaagttctgggaacgggatggtatttatggtgggaaatccacaacggatcgc
ccatcccgattcatctactaccttgcccaaaactttacaggcggcgttggtgttatcttg
gcttcctacgtccaaggggatgactctcgtttcttcctggctctcagtgatgagaatgtc
gtgaatatcataatggatgacctggcagccgtccaccagatgcccaaatgggagatccgg
aatctctgtccctctgcagtcgtaaagcaatggagcctggatcagtactctatgtgtgcc
tatactaccttcaccccttaccagtttatagattatagtgagactcttgggatgccagag
ggcagaatccattttgctggggaatatactgccaagcttcatggctag

DBGET integrated database retrieval system