KEGG   Pogona vitticeps (central bearded dragon): 110088410Help
Entry
110088410         CDS       T05000                                 

Gene name
RASSF5
Definition
(RefSeq) ras association domain-containing protein 5 isoform X1
  KO
K08015  Ras association domain-containing protein 5
Organism
pvt  Pogona vitticeps (central bearded dragon)
Pathway
pvt04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    110088410 (RASSF5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nore1-SARAH RA UN_NPL4
Motif
Other DBs
NCBI-GeneID: 110088410
NCBI-ProteinID: XP_020666322
Position
Unknown
AA seq 318 aa AA seqDB search
MTEGEAEPAACFGLVTKRIRKLFRHFPKSKSWSEGLHFQLKRSSRNVLLARDCKYTCHQE
CRSLIQLDCSQQEGQNRSKPSPENTLTQSYNQNVTKTVEEEKPKAPTIQELKEKIDNYNS
KVNNGLLMKLNDDGTYTGFIKVHLKLRRPVTVPAGIRPQSIYDALKEVNLARTTEKRTSF
YLPLDAIKQLHISSTTTVSEVIQGLLKKFMVVDNPQKFALFKQMQKDGQVLSQKLPVTEY
PLYLRLQAGPDTDLLSFVLKENETGEVEWDDFSIPELQNFLVILEREEKEKIQQVQKKYD
KFKQKLQEALKEANGKPG
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaggggaagcagagcctgcggcttgctttggactggtaacaaagagaatacgc
aagctcttcagacatttcccaaagtctaaatcatggtcagagggtcttcatttccaactc
aagagatccagcaggaacgtcttgctagcaagagactgcaagtacacatgccatcaagaa
tgcagaagcctcattcagctggattgcagccaacaggaaggacagaaccgcagcaaacct
tccccagaaaacacattaacacagagctacaaccagaatgtgacaaaaactgtggaagaa
gaaaaaccgaaagctcctaccattcaggagctgaaagaaaagattgacaattacaattca
aaagtcaacaacggcttgctgatgaagctgaatgatgacggcacttatacaggtttcatc
aaagtgcacttgaaattgcgccggcctgtgacagttccagcagggatcaggccacagtcc
atatatgatgccctcaaggaggtcaacctggccaggacaacagagaaaaggacttccttc
tacctgccactggatgccatcaaacagctgcacatcagcagtaccaccactgtgagtgag
gtgatccagggacttttgaagaaatttatggtggtggacaacccacagaaatttgcactt
ttcaagcagatgcagaaagatggtcaagttctatcccagaaacttccagtgacagagtat
cctttgtatctccggttgcaagcaggtcctgacacagaccttctaagctttgtgttgaag
gaaaatgaaacaggggaagttgagtgggatgacttctctattccagaactacagaatttc
ctagtcatactagaaagggaagaaaaagaaaaaatccagcaagttcagaaaaagtatgac
aagtttaaacaaaaactgcaagaggccttgaaagaagcaaatgggaagccgggataa

DBGET integrated database retrieval system