KEGG   Pogona vitticeps (central bearded dragon): 110088712Help
Entry
110088712         CDS       T05000                                 

Gene name
CACNG5
Definition
(RefSeq) voltage-dependent calcium channel gamma-5 subunit isoform X1
  KO
K04870  voltage-dependent calcium channel gamma-5
Organism
pvt  Pogona vitticeps (central bearded dragon)
Pathway
pvt04010  MAPK signaling pathway
pvt04260  Cardiac muscle contraction
pvt04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110088712 (CACNG5)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    110088712 (CACNG5)
   04261 Adrenergic signaling in cardiomyocytes
    110088712 (CACNG5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pvt04040]
    110088712 (CACNG5)
Ion channels [BR:pvt04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   110088712 (CACNG5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2 DHHC
Motif
Other DBs
NCBI-GeneID: 110088712
NCBI-ProteinID: XP_020666848
Position
Unknown
AA seq 232 aa AA seqDB search
MLLGMSTCGRKALTLLSSVFAVCGLGLLGIAVSTDYWLYLEEGIILPQNQSTEVKMSLHS
GLWRVCFLAGEERGRCFTIEYVMPMNVQLTSESTVNVLSLSLVVGLVLYISSINDEMLNR
TKDSETYFTYRYGWSFAFSAISFLLTESAGVMSVYLFMKRYTAEEMYRPHPGFYRPRLSN
CSDYSGQFLHPDAWVRGRSPSDISSDASLQMNSNYPALLKCPDYDQMSSSPC
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgcttttgggaatgagcacttgtggcagaaaagccctgaccctgctcagcagtgtgttt
gctgtgtgtggattggggctcctggggatcgctgtgagcaccgactattggctgtatctg
gaggaaggaatcatcctgcctcagaaccagagtactgaagtcaagatgtctctgcattcc
ggcctctggagagtttgctttttggcaggtgaagaacgtggaagatgtttcaccatagag
tacgtcatgccaatgaatgtccagctgacatcggaatcaaccgtcaatgtgttaagttta
tctctggttgtgggcctcgtcttgtacatctccagcattaatgatgaaatgctgaacaga
accaaggactccgaaacttacttcacatacagatacggatggtcgtttgctttctctgct
atctcctttctcctgacagagagtgcaggtgtcatgtctgtctacctattcatgaagaga
tacactgcggaagagatgtaccggcctcatcctggcttctaccgtccacgtctcagcaac
tgctctgattattctggccagttcctacaccccgatgcctgggttcgtggacgcagccct
tctgacatttccagcgacgcttctctccagatgaacagcaattatcctgctctacttaag
tgtcccgattatgaccagatgtcatcctctccatgttga

DBGET integrated database retrieval system