KEGG   Pogona vitticeps (central bearded dragon): 110088893Help
Entry
110088893         CDS       T05000                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase isoform X1
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
pvt  Pogona vitticeps (central bearded dragon)
Pathway
pvt00561  Glycerolipid metabolism
pvt01100  Metabolic pathways
Module
pvt_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    110088893 (MGLL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:pvt01002]
    110088893 (MGLL)
Enzymes [BR:pvt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     110088893 (MGLL)
Peptidases [BR:pvt01002]
 Serine Peptidases
  Family S33
   110088893 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 PGAP1 Esterase Lipase_3 Thioesterase Chlorophyllase2 Abhydrolase_5 TMEM117 DUF1057 Abhydrolase_3 DUF2048 LIDHydrolase DUF1350 DUF2974 LCAT
Motif
Other DBs
NCBI-GeneID: 110088893
NCBI-ProteinID: XP_020667171
Position
Unknown
AA seq 192 aa AA seqDB search
MMVVVEEEDAEAGKGQSSRMPEESSPRKTPQNVSYHDLPHLVNADGQYLFCRYWRPATTP
RGLVFVAHGAGEHCCRYDELAQMLTGINFFVFAHDHVGHGQSEGDRMVVSDFHVFVRDCL
QHIDLMKKDHPGLPVFLLGHSMGGAIAILTACERPNDFTGMVLISPLVVASPEVATPIKV
KIWKEMNFQHTS
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgatggtggtagtggaagaagaggatgcagaggcaggaaaaggtcagtcttctaggatg
ccagaggaaagttcccctcggaagactccccaaaatgtttcgtatcatgatcttccccat
ttggtcaatgctgatggacagtacctcttctgcagatattggaggccagccaccacccca
agaggcctggtgttcgttgctcacggtgctggagaacactgctgtcgctatgatgaactg
gcccagatgttgacaggaatcaacttttttgtgtttgctcatgaccacgttggccatggg
cagagtgaaggagaccgtatggttgtgtcagacttccatgtgtttgtgagagactgcttg
cagcacattgacctcatgaagaaagatcacccaggcctccctgtgttccttcttgggcac
tccatgggaggagccatcgccatcctcaccgcatgtgaaagaccaaatgactttacaggc
atggtattaatttctccattagtcgttgcgagcccagaagtggcgacaccaatcaaggta
aagatctggaaggaaatgaatttccagcacaccagctaa

DBGET integrated database retrieval system