KEGG   Pogona vitticeps (central bearded dragon): 110089066Help
Entry
110089066         CDS       T05000                                 

Definition
(RefSeq) stromelysin-1-like
  KO
K01394  matrix metalloproteinase-3 (stromelysin 1, progelatinase) [EC:3.4.24.17]
Organism
pvt  Pogona vitticeps (central bearded dragon)
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:pvt01002]
    110089066
Enzymes [BR:pvt01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.17  stromelysin 1
     110089066
Peptidases [BR:pvt01002]
 Metallo Peptidases
  Family M10
   110089066
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M10 Hemopexin PG_binding_1 Astacin Reprolysin_3 DUF4953
Motif
Other DBs
NCBI-GeneID: 110089066
NCBI-ProteinID: XP_020667501
Position
Unknown
AA seq 475 aa AA seqDB search
MVAIYLMLLFATVSYALPIRNEREKLELLQRYLKNYYNFTTTDGKPTLRWKANSPIMKKI
KEMQEFIGLEVTGSLDSRTLEAIQKPRCGNPDIGEFAFFSGQPKWGKKDLTYRILNYTPD
MKERDVQNAVEKAFKAWSRVSPLTFSPTQRDNADIMISFGSRDHGDFNPFDGPGGTVAHA
YAPSTGIGGDAHFDEDENWTHGLDGTNLYFVAVHEFGHSLGLFHSKDPNAVMFPVYRQPE
QTDNVLSQDDIDGIQHLYGPSSNPSEDPVEDSKPREPIRPTQSAIPTACDPQLTFDAVTS
LRGEILFFKNKHFWRKHPQYTQLDFSLISQFWSFVPTGVDAVSENSDKDEILLFKGNQFW
AARGEIRLSGYPKRIQSLGFPKEVKKIDAAFFNANEKQTYYFSAGKYWRYDETTQTLERK
PKNIKDGFPGIEGKVDAAFQHNGLLYFFRGTNQYEFDPNTRQVTRVRRANSWLSC
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggtggccatctacctcatgctgttatttgcaacagtgtcttatgcgctgccaatcaga
aacgaaagggaaaagctggaacttcttcagaggtacttaaaaaactattataacttcaca
acaacagatgggaaaccaacgttaagatggaaagccaacagcccaataatgaaaaaaatc
aaagaaatgcaagaatttattgggctagaagtgacaggcagtttggattctaggacgctg
gaggccattcagaaaccaaggtgtggaaacccagatattggagaatttgcgttcttctca
ggacaacccaaatgggggaagaaagatcttacctacaggatactgaattatacaccagac
atgaaagaacgtgatgtacagaatgcagtagagaaagcatttaaagcttggagccgagtt
tccccactaacgttctctccaactcaaagagacaacgcagatataatgatctcctttggc
tccagagatcatggagatttcaatccttttgatggccctggaggcaccgtcgcacatgct
tatgctcctagcactggtattggaggagacgcccattttgatgaggacgaaaactggact
cacggattagacggcaccaacttgtattttgtagccgttcatgaatttggtcattccctt
ggactcttccattctaaagatcccaatgctgtgatgttcccagtgtacaggcaacctgaa
caaacggataatgtcctctctcaggatgatattgatggcattcaacatctctatggacca
tcttctaatccatcagaagatccagtggaagacagcaaaccaagagaacccatcaggcca
acccagtctgcaataccaactgcttgtgaccctcagctgacatttgatgccgtcacatct
ttacgaggagaaatactgttctttaaaaacaaacatttctggcgaaagcaccctcagtac
acacagcttgatttcagcttgatttctcagttttggtcatttgtaccaaccggtgttgat
gctgtttctgaaaatagtgataaggacgaaatacttctgtttaaaggcaatcagttctgg
gctgcaagaggtgaaatcaggctttctggatatcccaaacgcattcaaagtttgggtttc
ccaaaagaagtcaagaaaattgacgcagcatttttcaatgccaatgaaaaacagacatac
tacttctccgctggcaaatactggagatatgatgaaaccacacaaactctggagaggaaa
ccaaaaaatatcaaagatggtttcccaggtattgaggggaaagttgatgctgcctttcag
cataatggattgttgtactttttcaggggaacaaatcaatatgaatttgaccctaatacc
agacaagttactcgggtcagaagggccaacagctggctttcgtgctga

DBGET integrated database retrieval system