KEGG   Pogona vitticeps (central bearded dragon): 110089618Help
Entry
110089618         CDS       T05000                                 

Definition
(RefSeq) heat shock cognate 71 kDa protein-like isoform X1
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
pvt  Pogona vitticeps (central bearded dragon)
Pathway
pvt03040  Spliceosome
pvt04010  MAPK signaling pathway
pvt04141  Protein processing in endoplasmic reticulum
pvt04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    110089618
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110089618
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110089618
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110089618
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pvt01009]
    110089618
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:pvt03041]
    110089618
   03009 Ribosome biogenesis [BR:pvt03009]
    110089618
   03110 Chaperones and folding catalysts [BR:pvt03110]
    110089618
   04131 Membrane trafficking [BR:pvt04131]
    110089618
   03051 Proteasome [BR:pvt03051]
    110089618
   03029 Mitochondrial biogenesis [BR:pvt03029]
    110089618
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pvt04147]
    110089618
Protein phosphatases and associated proteins [BR:pvt01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     110089618
Spliceosome [BR:pvt03041]
 Complex B
  Other components
   Prp19 complex
    110089618
 Complex C
   Prp19-CDC5 complex
    110089618
Ribosome biogenesis [BR:pvt03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    110089618
Chaperones and folding catalysts [BR:pvt03110]
 Heat shock proteins
  HSP70 / DNAK
   110089618
Membrane trafficking [BR:pvt04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    110089618
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    110089618
Proteasome [BR:pvt03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    110089618
Mitochondrial biogenesis [BR:pvt03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    110089618
Exosome [BR:pvt04147]
 Exosomal proteins
  Proteins found in most exosomes
   110089618
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C CRIC_ras_sig Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 110089618
NCBI-ProteinID: XP_020668456
Position
Unknown
AA seq 644 aa AA seqDB search
MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
MNPTNTVFDAKRLIGRRFDDPVVHSDMKHWPFHVINDAGRPKVQVEYKGESKTFYAEEIS
SMVLTKMKEIAEAYLGKTVNNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAA
IAYGLDKKVGGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNH
FVSEFKRKHKKDITDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRA
RFEELNADLFRGTLEPVEKALRDAKLDKAQVHDVVLVGGSTRIPKIQKLLQDFFNGRELN
KSINPDEAVAYGAAVQAAILCGDKSENVQDLLLLDVTPLSLGIETAGGVMTALIKRNTTI
PTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDI
DANGILNVSAVDKSTGKENKITITNDKGRLSKEEIERMVQEAEQYKAEDEIQREKIAAKN
SLESLAFNMKSTAEDEKLKDKLSPEDKQKILDKCNEVIAWLDRNQMAEKDEYEHQQKELQ
NVCNPIITKLYQGAGGMPGGMPGGFPGAGGAGSGSSGPTIEEVD
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagggtccagctgtaggcattgatctggggaccacctactcctgtgtgggtgtc
ttccaacatggcaaggtggagatcatcgccaacgaccaaggcaaccggacaacccccagc
tacgtggccttcacagatacggagcgcctcatcggggatgctgccaagaaccaagtggcc
atgaatcctaccaacacagtctttgatgccaagcgcctgatcggccgccgtttcgatgac
cctgtggtccattccgacatgaagcactggcctttccatgtgatcaatgacgccggccgt
cccaaagtgcaggtggagtacaaaggggaatcaaagaccttctacgcagaggagatctcg
tctatggtcctcaccaagatgaaggaaattgcagaggcttacctgggcaagaccgtcaac
aatgctgtgattacagtcccagcttatttcaacgactcccagagacaagccacaaaagac
gccggcactatcgcaggcctgaacgtcctccgtatcatcaatgaacccacagcagctgcc
atagcttacgggttggataaaaaggtaggcggggaacgcaacgtgctcatcttcgacctg
ggtggcggcacctttgacgtctccatcctgaccatcgaggacggcatctttgaggtgaag
tcaactgctggggacacccacttgggtggtgaagattttgacaaccgcatggtgaaccac
ttcgtgtccgagttcaagcgcaagcacaagaaggacatcacggacaacaagcgggcggtg
cggcggctgcgcacggcctgcgagcgggcgaagcgcaccctcagctcctccacccaggct
tccattgagatcgactccctctatgagggcattgacttctacacgtccattacccgggcc
cgttttgaagaactgaatgctgacctcttccgtggtactctggagcccgtagaaaaagcc
ttgcgtgatgccaagctggacaaggcccaggtccacgacgttgtgctcgttgggggctcg
acccgcatccccaagatccagaagctcctgcaggatttcttcaacggcagggaacttaac
aagagcatcaaccctgacgaagcagtggcttatggagcagcggtccaagctgccatcctc
tgtggggacaagtctgagaatgtccaggacttgctgctcttggatgtcacacccctctcc
ctgggtatcgagacggccggcggggtgatgacagccctgatcaagcggaacaccaccatc
cccaccaagcagacccagacgttcaccacttactctgacaaccagccaggagtgctgatc
caggtgtacgagggagagcgtgccatgaccaaagacaataacttgctaggcaagtttgag
ttgacagggattcctcccgctccgcgcggcgtcccccagattgaggtcacctttgacatt
gatgccaacggcatcctcaacgtctcggccgtggacaagagcaccggcaaggagaataag
atcaccataaccaacgataaaggccgtcttagcaaggaggagattgagcgcatggtgcaa
gaggcggagcaatacaaagctgaagatgaaatccagagggagaagattgcggctaagaac
tccttggagtccctggcgttcaacatgaagagcacggcggaggacgagaagctcaaggac
aagctgtccccggaggacaagcagaagatcctggacaagtgcaacgaggtcatagcctgg
ctggacaggaaccagatggcagaaaaggatgagtacgagcaccagcagaaggagctgcag
aacgtttgcaaccccatcatcacgaagctataccaaggggctggaggcatgccggggggg
atgcctgggggcttcccaggagcaggaggagctgggagcggctcttcaggccccaccatt
gaggaggtggattaa

DBGET integrated database retrieval system