KEGG   Pogona vitticeps (central bearded dragon): 110090098Help
Entry
110090098         CDS       T05000                                 

Definition
(RefSeq) arylamine N-acetyltransferase, pineal gland isozyme NAT-10-like
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
pvt  Pogona vitticeps (central bearded dragon)
Pathway
pvt00232  Caffeine metabolism
pvt00983  Drug metabolism - other enzymes
pvt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    110090098
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    110090098
Enzymes [BR:pvt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     110090098
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acetyltransf_2
Motif
Other DBs
NCBI-GeneID: 110090098
NCBI-ProteinID: XP_020669246
Position
Unknown
AA seq 290 aa AA seqDB search
MNTAKYFARTGYKGSLDTLDLETLTAVFQHHIRAVPFENLSIHCGETITLDLEDIYTKIV
KKRRGGWCMENNLLLSWVLKTMGYDTTILGAYVYFPQQKAYDTIMSHLILQVVIDGKSYI
VDAGFGVSYQMWQPMELVSGKDQPQIPGVFRFTEENGIWYFEKIRRKQHIPTETSSSLDL
IEKKERRNVYLFSLEPRMVEDFRSPCSYLQTSPDSLCTKKSICSLQTINGFRALVGWTLS
EMTYRYKEDVDLVEFTTLKNDEVEKTLEEKFGITLENKLVPVNLPEFFTI
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaacactgccaaatattttgcgcgaacgggctacaaaggctccctcgacactctcgat
ttagaaacgctgacggccgttttccagcaccacatccgggccgtgcccttcgaaaacctc
agcatccactgcggggaaaccataacactggacttagaggacatctatacaaaaattgta
aagaaaaggcgtggaggttggtgcatggagaacaacctgctgttgtcttgggttctgaaa
accatgggctacgacacgactattctgggggcctatgtgtacttcccacagcaaaaggca
tatgacaccataatgtcccatttaatcctccaagtagtgattgatggcaaatcttacatc
gttgacgctggcttcggtgtctcctaccaaatgtggcaacccatggagctagtttctggc
aaagatcagcctcagatccctggagttttccgcttcacagaagaaaatgggatttggtac
tttgaaaaaataagaaggaagcaacacatccctacagaaacctcctccagcttggatctc
atcgaaaagaaggagcgcaggaacgtttatctgttcagccttgagccacggatggttgaa
gattttcgatccccatgttcttatctccaaacatccccggattctctgtgtacaaagaaa
tcaatttgcagccttcaaactataaatgggtttcgggctttggttgggtggacactctca
gagatgacatacagatacaaagaggatgtggatctggtagaattcacaacgctgaaaaac
gacgaggtggagaaaacactggaagagaagttcggaataactctggagaacaaactcgtt
cccgtcaacctcccagaattttttacaatttaa

DBGET integrated database retrieval system