KEGG   Pogona vitticeps (central bearded dragon): 110091692
Entry
110091692         CDS       T05000                                 

Gene name
ADCY4
Definition
(RefSeq) adenylate cyclase type 4 isoform X1
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
pvt  Pogona vitticeps (central bearded dragon)
Pathway
pvt00230  Purine metabolism
pvt01100  Metabolic pathways
pvt04020  Calcium signaling pathway
pvt04114  Oocyte meiosis
pvt04261  Adrenergic signaling in cardiomyocytes
pvt04270  Vascular smooth muscle contraction
pvt04371  Apelin signaling pathway
pvt04540  Gap junction
pvt04912  GnRH signaling pathway
pvt04914  Progesterone-mediated oocyte maturation
pvt04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    110091692 (ADCY4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    110091692 (ADCY4)
   04020 Calcium signaling pathway
    110091692 (ADCY4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    110091692 (ADCY4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    110091692 (ADCY4)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    110091692 (ADCY4)
   04914 Progesterone-mediated oocyte maturation
    110091692 (ADCY4)
   04916 Melanogenesis
    110091692 (ADCY4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110091692 (ADCY4)
   04270 Vascular smooth muscle contraction
    110091692 (ADCY4)
Enzymes [BR:pvt01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     110091692 (ADCY4)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N HNOBA
Other DBs
NCBI-GeneID: 110091692
NCBI-ProteinID: XP_020671555
Position
Unknown
AA seq 949 aa
MLPVGMEDAVAAGMVSSLSHIIVLTVYLSMKPGSQLDLTVQLLANLVIFICGNLVGAYHK
HLMEMALGETFHETFNLIQSRVKLESEKRHQEHLLLSILPAYIALEMKAEIIERLRDGGQ
AQHRHESANNFHNLYVKRHQNVSILYADIVGFTLLASECSPKELVLMLNELFGKFDQIAK
DNECMRIKILGDCYYCVSGLPVSLPNHARNCVKMGLDMCRAIKKLRDATGVDINMRVGVH
SGNVLCGVIGLQKWQYDVWSDDVTLANHMEAGGVPGRVHITEATLSHLGGVYAVEEVCCW
HRDPYLKENRIRSFLVIDPRAKEESSCDTLSPVPGESYKMRALVRMTRYLESWGAAKPFA
NLQNLDNLPPESAGFVRNNHSEISLGSLNQQRTMERGRAPRSPDEDLEGVDEKFFQLIEQ
LNSQKQWKKSEDLNRITLYFKEQSLEKEYRLSALPSFNYYTACTFLVFTSNFVIQILVVN
KTEALAISYGISFFLFLLLLLACFASHLAKCFLKGPKSLYWIPSISASICTQPWLRVSLG
IVTILVVLTMAVLNLFFMPENLCFLKAQNPTAVSTNITREFVRLGSLFSVPYYIYCCILG
FLSCSLFLHMNFELKLTMLTLCLAIYNAMFLRTHSWLSDCYVSYLYPNQTALRPGVLKEP
KMMGAFSFFVFFFTLLALARQNEYYCRLDFLWKKKFKKEREEIETMENLNRVLLENVLPA
HVAQTFMRQNRRNEDLYHQSCDCVCVLFASIPDFKEFYSESNVNREGLECLRLLNEIIAD
FDELLLKPKFSGVEKIKTIGSTYMAATGLNMAASQDNQQDGEQSYTHLGTMVEFAMALVA
KLDIINKHSFNSFKLRAGINHGPVVAGVIGAQKPQYDIWGNTVNVASRMESTGVLSKIQV
TEETAKVLETLGYPCSLRGVIKVKGKGQLRTYFVCTDTVRSGPQVPILS
NT seq 2850 nt   +upstreamnt  +downstreamnt
atgttgcccgtcggcatggaagatgctgtggctgctggcatggtctcctccctctcccat
atcatagtcctcacggtctacctctccatgaagcccggctcacaactggacttgactgtg
cagctcctggccaatctggtgatttttatatgtggcaacttggttggggcctaccacaaa
catctgatggaaatggccttgggggagactttccatgaaacgttcaacctcatccaatcc
cgagtgaagctggagtctgaaaaacggcatcaggagcatctgctcctctccatccttcca
gcctacatcgccttggagatgaaggctgagatcattgagaggcttcgggatgggggccag
gcgcaacatcggcacgagagtgccaataatttccacaacctctatgtcaagcgccaccag
aacgtcagcattctctatgcagacattgttgggttcactctcctggccagtgaatgctcc
cccaaagaactagttcttatgctcaatgaactctttggcaagttcgatcagatcgccaag
gataacgagtgcatgcggataaagattttgggtgactgctactactgtgtctccggattg
cccgtctctctgcccaaccacgcccgtaactgtgtcaagatggggcttgacatgtgccgg
gccatcaagaagttgcgagatgccactggagtggatatcaacatgagagtgggggtccat
tctggaaacgtcctctgtggggtgattggacttcagaagtggcagtatgatgtctggtct
gatgacgtgactttagccaatcacatggaagcagggggtgtgccagggagggtgcatatc
acggaggccacactgtcacacctcggtggtgtctatgctgtggaggaagtttgttgctgg
catcgcgatccttacctgaaggagaaccgaatcagatctttcttggtcatcgatcccagg
gctaaagaggaaagctcctgtgatactctttcacctgtgccaggtgagagctacaaaatg
agagcgttggtccggatgacgcgctacctggagtcctggggtgccgccaaaccttttgct
aacctccaaaacctagacaatcttcctccagagtcagcaggatttgtccggaacaaccac
tcggagatttctctggggtctttgaaccagcagaggaccatggaacggggccgtgcccct
aggagcccagatgaagacctggaaggtgtggatgaaaagttcttccaactgattgagcag
cttaattcacagaaacaatggaagaagtcagaagatctgaaccgcatcaccctgtacttc
aaagagcagtcccttgagaaagagtaccggctctcggcactgccgtctttcaactactac
actgcctgcacctttttggtgttcacctccaactttgtcatccagatccttgtggtcaac
aagacggaagctttagccatatcctatggaatttccttcttccttttcctccttctcctc
ctcgcctgttttgcaagccatttagcaaaatgttttctgaaaggcccaaagtcactctac
tggattccctccatctcggcaagtatctgcactcaaccgtggcttcgggtctcgttgggt
atcgtcactatcctcgtggtcctcaccatggctgtgctgaatttgttctttatgccagag
aacttgtgctttttgaaagctcagaatcccaccgcggtgagcacgaacatcacacgagag
tttgttcgcttgggctctctctttagtgtgccatattacatctactgttgtatcttggga
ttcctgtcatgctctctcttcctacacatgaactttgagctcaaactcaccatgttgact
ctctgcctcgccatctacaatgccatgttccttcggacccactcgtggctctctgactgc
tatgtctcctacctctaccctaaccagaccgctctcaggcctggggtactgaaggaaccc
aagatgatgggagccttctcattctttgtcttcttcttcacactcctggccctggccagg
cagaatgagtattactgccgcctggacttcttgtggaaaaagaagttcaagaaggaacgg
gaggagattgaaaccatggaaaacctcaaccgtgtcttgttggaaaacgtgctgccagct
cacgtcgctcagacgtttatgcgccagaaccggcgcaatgaggatctctaccaccagtcc
tgtgactgtgtctgcgttctgtttgcatccatcccagatttcaaagagttttactcggag
tccaacgtcaaccgtgaggggcttgagtgccttcgactgctcaatgagattattgctgac
tttgatgagcttctcctgaagcccaagttcagcggggtggagaaaatcaagaccatcggc
agcacctacatggcagccaccggtttaaacatggcagccagccaggataaccaacaggac
ggcgagcaaagctacacccacctggggaccatggtggagtttgccatggcgctggtggcc
aagctggacattatcaacaagcattctttcaacagttttaagcttcgtgcgggtataaac
catggcccggttgtagctggggtgatcggagcccaaaaaccccagtatgatatttggggg
aacacagtgaatgtggccagtcggatggagagcacaggtgtgctgagcaaaatacaggta
actgaggaaacagccaaggttctagagacattggggtatccctgctccttacgtggggtc
atcaaggtgaagggcaaagggcaactgcgaacatactttgtctgtaccgacacagtccga
tctgggccccaagtgccaattctgagctga

DBGET integrated database retrieval system