KEGG   Phaseolus vulgaris (common bean): PHAVU_001G008600gHelp
Entry
PHAVU_001G008600g CDS       T03093                                 

Definition
(RefSeq) hypothetical protein
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
pvu  Phaseolus vulgaris (common bean)
Pathway
pvu03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:pvu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    PHAVU_001G008600g
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:pvu03041]
    PHAVU_001G008600g
Enzymes [BR:pvu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     PHAVU_001G008600g
Spliceosome [BR:pvu03041]
 Complex C
  Other components
   Step II factors
    PHAVU_001G008600g
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind S1 Helicase_C DEAD AAA_22 AAA_19 AAA_30 T2SSE AAA Sigma54_activ_2 Flavi_DEAD ABC_tran AAA_16 AAA_14 PhoH
Motif
Other DBs
NCBI-GeneID: 18639996
NCBI-ProteinID: XP_007160687
UniProt: V7CUW8
Position
1
AA seq 1201 aa AA seqDB search
MAVDNPEDGLKKLEYLSLVSKVCTELESHTGTGDKVLAEFITELGRSSENVEDFDAKLKE
NGAEMPDYFVRTLLTIIHAILPPKPKDLKKEKESSNGKTKFKALAIADDRDRAKELRKEM
ESEAKEKLSEQIEEDDGYRDRDRRDRRRDRYEEDDRRDHRRRGRDRDDEDDRRDYSRRGR
DRDDEDDRRDYSRRGRDKYDKDRDRDKDGDKYERRRRDDYEENGRGRENGDREGNRKGTR
QVSGEPELYAVYKGRVSRVMETGCFVQLEDIRGKEGLVHVSQMATRRITNAKDVIKRDQE
VYVKVISVSGQKLSLSMRDVDQHTGKDLLPLKKSSEDDTLRMNPQGLRDGPVSRTGLSGI
RIVEEDDVGSSRRPLKRMSSPEKWEAKQLIASGVMGVSEYPTYDEEGDGLLYQEEGAEEE
LEIELNEDEPAFLQGQSRYSMDMSPVKIFKNPEGSLGRAAALQSALIKERREVREQQQRT
MLDSIPKDLNRPWEDPMPESGERHLAQELRGVGLSAYDMPEWKKDAYGKTITFGQRSKLS
IQEQRQSLPIYKLKKELIQAVHDNQVLVVIGETGSGKTTQVTQYLAEAGYTTRGKIGCTQ
PRRVAAMSVAKRVAEEFGCRLGEEVGYAIRFEDCTGPDTVIKYMTDGMLLREILVDENLS
QYSVIMLDEAHERTIHTDVLFGLLKQLVKRRPELRLIVTSATLDAEKFSGYFFNCNIFTI
PGRTFPVEILYTKQPESDYLDASLITVLQIHLTEPEGDVLLFLTGQEEIDFACQSLYERM
KGLGKNVPELIILPVYSALPSEMQSRIFDPAPPGKRKVVVATNIAEASLTIDGIFYVIDP
GFAKQNVYNPKQGLDSLVITPISQASAKQRAGRAGRTGPGKCYRLYTESAYRNEMSPTTI
PEIQRINLGMTTLNMKAMGINDLLSFDFMDPPSPQALISAMEQLYSLGALDEEGLLTKLG
RKMAEFPLDPPLSKMLLASVDLGCSDEILTIIAMIQTGNIFYRPREKQAQADQKRAKFFQ
PEGDHLTLLAVYEAWKAKNFSGPWCFENFVQSRSLRRAQDVRKQLLTIMDKYKLDVVSAG
KNFTKVRKAITAGFFFHAARKDPQEGYRTLVENQPVYIHPSSALFQRQPDWVIYHELVMT
TKEYMREVTVIDPKWLVELAPRFFKVADPTKMSKRKRQERIEPLYDRYHEPNSWRLSKRR
A
NT seq 3606 nt NT seq  +upstreamnt  +downstreamnt
atggcggtagataatcctgaggatggattgaagaagctggaatacttgtcgcttgtgtcg
aaggtgtgcaccgagttggagtcccacaccggcaccggcgacaaagttctagcggagttc
atcactgagttgggtcgatcgtcggagaatgttgaggattttgacgcgaagttgaaggag
aatggtgcggagatgccggattactttgtccgaacgctcctcactattattcacgcgatt
ctccctccgaagccgaaggatttgaagaaggagaaagagagtagcaacggcaagaccaag
ttcaaggctctggccatcgcagacgatagggaccgggccaaggagcttcggaaggagatg
gaatctgaggccaaggagaagctgagtgagcaaattgaggaagatgatgggtacagagac
agagatcgaagagataggcgcagagataggtatgaggaagatgatagaagggatcaccgc
agaagaggaagagacagagatgatgaagatgatagaagggattacagcagaagaggtaga
gatagagacgatgaagatgataggagggattacagcagaagaggaagagataagtatgat
aaagatagagatagagataaagatggtgataagtatgagaggcgcaggagagatgattat
gaagagaatgggcgcggaagggagaatggggatagagaggggaacagaaagggtacacgg
caagtttctggtgaacctgaattatatgccgtttacaaagggagggtgtccagggtaatg
gagactggatgctttgtccagttagaagacataagagggaaggaggggttggtccatgtg
tcacagatggccactcggaggatcacaaatgccaaagacgtcattaagcgcgaccaggag
gtttatgtaaaggtgatctcagtttcgggacagaagttgtctctttccatgagggacgtt
gatcagcacacaggtaaggatctccttccgttgaagaagagctccgaggatgataccttg
aggatgaatccgcagggtttaagggatgggccggtttccaggacagggctttcaggtatc
aggattgtagaagaagatgatgttggttcttcgcggagacctctgaagagaatgagctca
ccggagaaatgggaagcaaaacagttgattgcgtcaggtgtgatgggtgtttcagagtac
ccaacttatgatgaagagggagatggattgctgtaccaagaggaaggtgctgaggaggag
cttgagattgagttgaatgaggatgaacccgcattcttgcaagggcagagcagatactca
atggatatgtctcctgttaagatttttaagaatcctgaaggttctctgggtcgagctgct
gcactccagtctgcacttataaaggagcggagggaagtgcgagaacaacaacaacggaca
atgcttgattcaattccgaaggatctcaatcggccttgggaagaccctatgccagagtca
ggtgaaaggcatcttgcccaggagcttagaggtgttggcttatcagcctatgatatgcca
gaatggaagaaggatgcatatgggaaaacaattacctttgggcaaaggtcaaagctttct
attcaggagcagaggcagagtttgccaatttacaagttaaaaaaagaattgattcaggct
gtgcatgataatcaggtgttggtagttattggagaaactggttcaggtaagactactcag
gttacacagtatcttgccgaagctggttataccactagaggaaaaattggatgtactcaa
cctcgtagggtggctgcaatgtcagttgcgaagagggtagccgaagagtttggttgtaga
ttgggagaagaagtaggttatgccattcggtttgaggattgcactggaccagatactgtt
atcaagtacatgacagatggtatgcttcttagggagatattggtcgatgagaatctgtca
cagtattctgttataatgcttgacgaagcccatgaaagaactattcatactgatgttctt
tttggactgctcaagcagctagtgaagcgaagacctgaattgcgattgattgtcacctct
gctacactggacgctgagaaattttcaggatatttctttaactgtaacatctttacaatt
cccggtagaacttttcctgtagagatactttatactaaacagcccgaaagtgattattta
gatgcatctttaataactgtccttcagatccacttgacggagcccgagggagacgttctt
ctctttttgactgggcaagaggagattgattttgcttgccaatctctatatgagagaatg
aaaggattaggtaagaatgttccagagctgatcattttaccggtttatagtgcccttcct
agtgaaatgcagtctaggatatttgaccctgcccctcccgggaaaaggaaagtggttgtg
gctactaacattgctgaggcttctttgactattgatgggatattttatgttattgatcct
ggatttgctaagcaaaatgtttataacccaaagcaaggtcttgattctttggtgataact
ccaatttcacaagcatcagccaaacaaagagctggacgggcagggcgtactggacctggg
aagtgttatcgcctttataccgagagtgcatataggaatgagatgtctccaactacaatt
cctgagattcaaaggataaatctggggatgactacacttaatatgaaagctatggggata
aatgatctactgtcctttgattttatggatccaccatcacctcaagcactgatttctgcc
atggagcagctttatagtcttggagcattggatgaagagggccttttgaccaaattgggg
aggaaaatggcagaatttcctttggatccacctttgtccaagatgttgcttgccagtgtg
gaccttggatgcagtgatgaaattttgaccataattgccatgatccagaccggtaatata
ttttacaggccaagggaaaagcaagctcaagcagatcagaagagggcaaagtttttccag
ccagagggtgatcatcttacactacttgctgtttatgaggcttggaaagccaagaatttt
tctgggccttggtgttttgagaatttcgtgcaatccagatcattgagaagagcacaggat
gtcaggaaacaacttctcaccattatggataagtacaaattggatgttgtaagtgctgga
aaaaacttcaccaaagtaaggaaggctatcactgctggattcttttttcatgctgccaga
aaggatccccaagaagggtacagaaccctagttgagaaccaacctgtgtatatccatcca
agttctgctttgttccagaggcagccagactgggtcatataccatgagcttgtgatgaca
actaaggagtatatgcgtgaggtcactgtcatagaccccaaatggcttgttgaattggct
ccaagatttttcaaagtggcagatcctacaaagatgagcaagcggaagcgtcaagagcga
attgaaccactctatgatagataccacgagccaaattcatggcgtttgagtaagcgccgt
gcatga

DBGET integrated database retrieval system