KEGG   Phaseolus vulgaris (common bean): PHAVU_001G036700gHelp
Entry
PHAVU_001G036700g CDS       T03093                                 

Definition
(RefSeq) hypothetical protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
pvu  Phaseolus vulgaris (common bean)
Pathway
pvu00052  Galactose metabolism
pvu00500  Starch and sucrose metabolism
pvu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pvu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    PHAVU_001G036700g
   00500 Starch and sucrose metabolism
    PHAVU_001G036700g
Enzymes [BR:pvu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     PHAVU_001G036700g
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N
Motif
Other DBs
NCBI-GeneID: 18640280
NCBI-ProteinID: XP_007161024
UniProt: V7CUF8
Position
1
AA seq 398 aa AA seqDB search
MEISGEVASSHNLNSTMYKVPQKQPYRTWYHFQPPQCWMNDPNAPMYYKGVYHFFYQHNP
HAATFGEKMVWAHSVSYDLINWIHLDHAIEPSEQFDFNGCWSGSATIIPGKEKPVILYTG
IDDKKHQVQNIAMPKNPSDPFLREWVKHPQNPVMTPPSGVEVDNFRDPSTAWQGKDGKWR
VVIGAQNGDEGKVVLYQSEDFANWTVELKPFFASDNTGVCECPDFFPVSINSTNGVDTSV
QNQSVRHVLKISYLRLHQDYYFLGKYANEDGNFTPDVKFTGTSLDLRLDYGKFYASKSFF
DHAKSRRILWGWVEECDTSHDDIEKGWAGLQCIPRQVWLDESGNRLMQWPIEEIETLRDK
HISIVGEKLVGGSILEISGITASQVSKLLLYFVTFFSF
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggagatcagtggagaggtagcatcctcacacaacctcaattctaccatgtataaggta
cctcagaaacaaccttatagaacttggtaccactttcaaccccctcaatgttggatgaat
gatccaaatgcaccaatgtactacaaaggagtttaccactttttctaccagcataatcct
catgcagcaaccttcggtgagaaaatggtgtgggctcactctgtgtcctatgatctcatc
aactggattcatctggaccatgctattgagccaagtgaacagtttgacttcaacggttgt
tggtcaggctcagccactataatcccaggcaaagaaaaacctgtgattttgtacacagga
attgatgataaaaaacaccaagttcaaaacatagctatgccaaagaatccatcagacccc
ttcttaagggaatgggtgaaacaccctcaaaaccctgtcatgactccaccaagtggagtt
gaagttgataatttcagagacccttcaactgcttggcagggaaaggatggaaaatggagg
gtagtcattggtgctcaaaatggtgatgaagggaaggtagttctttaccaaagtgaggat
tttgctaattggacagtggaattgaaacctttttttgcatcagataatactggagtttgt
gagtgtccagatttttttcctgtgtccatcaatagtacaaatggggtggatacatctgtt
caaaatcaaagtgttagacatgtattaaagataagctatctacggttacatcaggactat
tattttcttggtaagtatgccaatgaagatggaaactttactcctgatgttaaattcaca
ggaactagtttggacttaaggttagactatggtaaattttatgcttcaaagtcatttttt
gaccatgctaagagcagaaggatattatgggggtgggtggaggagtgtgacactagccat
gatgacattgagaaaggatgggctggtcttcagtgtattccaagacaagtttggcttgat
gaaagtggaaacaggctaatgcaatggccaattgaagagatagaaacactacgtgacaaa
cacattagcatagtgggagagaaactggttggtggatcaattcttgaaatctcaggtatc
actgcatcacaggtaagtaaacttctgctgtattttgtcacattcttttctttttaa

DBGET integrated database retrieval system