KEGG   Phaseolus vulgaris (common bean): PHAVU_001G169000gHelp
Entry
PHAVU_001G169000g CDS       T03093                                 

Definition
(RefSeq) hypothetical protein
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
pvu  Phaseolus vulgaris (common bean)
Pathway
pvu03040  Spliceosome
pvu04141  Protein processing in endoplasmic reticulum
pvu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:pvu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    PHAVU_001G169000g
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    PHAVU_001G169000g
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    PHAVU_001G169000g
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pvu01009]
    PHAVU_001G169000g
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:pvu03041]
    PHAVU_001G169000g
   03009 Ribosome biogenesis [BR:pvu03009]
    PHAVU_001G169000g
   03110 Chaperones and folding catalysts [BR:pvu03110]
    PHAVU_001G169000g
   04131 Membrane trafficking [BR:pvu04131]
    PHAVU_001G169000g
   03051 Proteasome [BR:pvu03051]
    PHAVU_001G169000g
   03029 Mitochondrial biogenesis [BR:pvu03029]
    PHAVU_001G169000g
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pvu04147]
    PHAVU_001G169000g
Protein phosphatases and associated proteins [BR:pvu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     PHAVU_001G169000g
Spliceosome [BR:pvu03041]
 Complex B
  Other components
   Prp19 complex
    PHAVU_001G169000g
 Complex C
   Prp19-CDC5 complex
    PHAVU_001G169000g
Ribosome biogenesis [BR:pvu03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    PHAVU_001G169000g
Chaperones and folding catalysts [BR:pvu03110]
 Heat shock proteins
  HSP70 / DNAK
   PHAVU_001G169000g
Membrane trafficking [BR:pvu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    PHAVU_001G169000g
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    PHAVU_001G169000g
Proteasome [BR:pvu03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    PHAVU_001G169000g
Mitochondrial biogenesis [BR:pvu03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    PHAVU_001G169000g
Exosome [BR:pvu04147]
 Exosomal proteins
  Proteins found in most exosomes
   PHAVU_001G169000g
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C DDR Hydantoinase_A PG_binding_4
Motif
Other DBs
NCBI-GeneID: 18641660
NCBI-ProteinID: XP_007162654
UniProt: V7CZ55
Position
1
AA seq 651 aa AA seqDB search
MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN
QVAMNPINTVFDAKRLIGRRFTDAPVQSDIKLWPFKVIAGPADKPTIVVNYKGEEKQFAA
EEISSMVLMKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD
NRMVNHFVQEFKRKNKKDISGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLYEGIDFY
STITRARFEELNMDLFRKCMEPVEKCLRDAKMDKKSVDDVVLVGGSTRIPKVQQLLQDFF
NGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLI
PRNTTIPTKKEQVFSTYSDNQPGVLIQVFEGERARTRDNNLLGKFELSGIPPAPRGVPQI
TVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDDIEKMVQEAEKYKSEDEEHKK
KVEAKNALENYAYNMRNTVKDEKIGGKLDPADKKKIEDAIEQSIQWLDSNQLAEADEFED
KMKELESICNPIIAKMYQGGAGPDMGGAPPADTEYTPSGGSGAGPKIEEVD
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atggccggtaaaggtgaaggtcctgctatcggaatcgatcttggaaccacgtactcttgt
gttggggtctggcaacatgaccgcgttgaaatcattgccaacgaccaaggcaacagaacg
acgccgtcttacgttggattcaccgacaccgaacgtctaattggtgacgccgccaagaac
caagtcgccatgaaccctatcaacaccgtctttgatgcaaagaggttgattggtcgtaga
ttcaccgatgcccctgttcagagtgatatcaaattgtggcctttcaaggtcattgctggt
cctgctgataagccaacaattgtagttaactacaagggtgaggagaaacaatttgctgct
gaagaaatctcttcaatggtgctcatgaagatgcgtgagattgctgaggcttacttggga
tctacagtaaagaatgctgttgttactgtccctgcttacttcaatgattctcagcgtcaa
gctactaaggatgctggtgttattgctggtcttaatgtcatgcgtattatcaatgagcct
accgcagctgccattgcatatggtctcgacaagaaagcaacaagtgtgggtgagaagaat
gtgttaatctttgatcttggtggtgggacattcgatgtttctttacttactatcgaggag
ggcatctttgaggtgaaagccacagcaggtgacacacatcttggaggagaggatttcgat
aacaggatggtgaaccactttgtacaagagtttaagagaaagaacaagaaggacataagt
ggaaaccccagagcacttagaaggttgaggacctcatgtgagagggctaagagaacctta
tcttctactgcccagactaccattgaaattgattctctatacgagggaattgatttctac
tccaccattactcgtgccagatttgaggagctcaatatggatctcttcagaaaatgtatg
gaaccagtggagaaatgtctaagggatgctaagatggacaaaaaaagtgtggatgatgtt
gtccttgttggtggttctaccagaattcccaaggttcagcaactactccaggacttcttt
aatggaaaggagctttgcaagagcattaacccagacgaggctgttgcttatggtgctgct
gttcaggcagcgatcttaagtggtgagggcaatgagaaggttcaagatcttctccttctt
gatgttactcctctgtctcttgggttggagaccgctggtggtgtgatgactgtcctgatc
cctaggaacaccactattccaacaaagaaggagcaggttttttcaacatactctgataac
cagcctggtgtgttgatccaggtctttgagggtgagagagcaaggaccagagataacaat
ttgttgggcaaatttgaactttctggtattcctcctgctcccaggggtgttccacaaatt
acagtgtgctttgacattgatgccaatggtattttgaatgtctctgctgaagataaaacc
actggccagaaaaataagatcaccatcaccaatgacaaaggtagactgtcgaaggatgat
atcgagaagatggttcaagaggctgagaagtacaaatccgaggatgaagagcataagaag
aaggttgaagccaagaacgccttggaaaactatgcgtacaatatgaggaacacagtgaag
gatgagaagattggtggcaaactggatcctgctgacaagaagaagattgaggacgctatt
gagcaatctatccaatggctggacagcaaccagcttgcagaggcagatgagtttgaggac
aaaatgaaggaattggaaagcatctgcaatcctatcattgccaaaatgtaccagggtggt
gctggtccagacatgggtggtgctcctccggcagatactgaatatactccttctggtgga
agtggcgctggccccaagattgaggaagtcgactaa

DBGET integrated database retrieval system