KEGG   Phaseolus vulgaris (common bean): PHAVU_001G169900gHelp
Entry
PHAVU_001G169900g CDS       T03093                                 

Definition
(RefSeq) hypothetical protein
  KO
K03254  translation initiation factor 3 subunit A
Organism
pvu  Phaseolus vulgaris (common bean)
Pathway
pvu03013  RNA transport
Brite
KEGG Orthology (KO) [BR:pvu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    PHAVU_001G169900g
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:pvu03012]
    PHAVU_001G169900g
Translation factors [BR:pvu03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    PHAVU_001G169900g
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCI DUF711
Motif
Other DBs
NCBI-GeneID: 18641669
NCBI-ProteinID: XP_007162664
UniProt: V7CZ62
Position
1
AA seq 954 aa AA seqDB search
MTSFLKPENALKRAEELINVGQKQDALQTLHDLITSKRYRAWQKTLERIMFKYVELCVDM
RKGRFAKDGLIQYRIICQQVNVSSLEEVIKHFMHLSTEKAEQARSQAQALEEALDVDDLE
ADKRPEDLMLSYVSGEKGKDRSDRELVTPWFKFLWETYRTVLEILRNNSKLEALYAMTAH
RAFQFCKQYKRTTEFRRLCEIIRNHLANLNKYRDQRDRPDLSAPESLQLYLDTRVEQLKI
ATELELWQEAFRSVEDIHGLMCLVKKTPKPSLMVVYYVKLTEIFWISSSHLYHAYAWFRL
FLLQKSFNKNLSQKDLQLIASSVVLAALSVPPHDRTHGASHLELEHEKERNLRMANLIGF
NLETKPESREMLSRSSLLAELASKGVMSCVTQEVKDVYHLLEHEFHPSDLALKALPLITK
ISKLGGKLSTASSVPEVQLSQYVPALERLATMRLLQQVSNVYQTMKIETLTGMIPFFDFS
VVEKIAVDAVKQKFVSMKVDHMKNVVIFCKTSLESDGLRDHLANFAEQLNKARQMIYPPD
RKPSKLGALLPTLTEVVAKEHKRLLARKSIIEKRKEEQERQLLEMEREEESKRLRLQKIT
EEAEQRRLATEYEQRKNQRILREIEEREIEEAQALLQEAEKRIKKKGKKPIIEGDKITKQ
TLMELTLTEQLRERQEMEKKLQKLAKTMDYLERAKREEAAPLIEAAYQQRLVEERLLHER
EQQQEVEVSKQRHEGDLKEKERLARMMGNKEIYEVRVVSHRQAEFNRLRREREERISRIL
QSRRQEREKLRKLKYYLKLEEERQQKMHEEEEARKREEAERRKKEEAERLAKLAEIAEKQ
RQRERELEEKEKQRREALLGRAAEPAPPARPLESVTAPAAAAAAAAAPTPGKYVPKFRRT
ERTGTDPPPETDRWSNSSSSRQDGDRWRSDDKRTSYVAGGGGSRSSSSWSRNPR
NT seq 2865 nt NT seq  +upstreamnt  +downstreamnt
atgacatcgttcttaaagcctgagaatgctctcaaaagggcggaagagttaatcaatgtt
gggcagaagcaggatgctttacagactcttcatgacctcattacctcaaagagatacaga
gcatggcagaagacacttgaacggattatgtttaagtatgttgaactttgtgtggacatg
cgcaaaggtcggtttgcaaaagatggacttattcagtataggataatatgtcagcaagtc
aatgttagttcactggaggaggtgatcaaacactttatgcatctgtcaactgagaaagct
gaacaagctcggagtcaagcacaggcattagaagaggcccttgatgttgatgatttagag
gctgataaaaggccagaggacttgatgttgagttatgtcagtggtgagaaaggaaaggac
agatctgatcgagagcttgttaccccatggtttaaatttctttgggaaacttaccggaca
gtgctcgagatcttgcgaaacaactcaaaactggaagctttatatgctatgacagctcat
cgagctttccagttctgtaagcaatataaacgaacaacagagttccgcagactttgtgaa
atcataagaaaccatttggctaatctcaataaataccgtgaccaaagagataggcctgac
ctttcagctcctgaaagcttacaactgtatcttgatactagagttgagcagctgaaaatt
gccactgaacttgaactctggcaggaagccttcagatcagtggaggatatacatggactg
atgtgcttggtcaagaaaactcccaagccatctttgatggttgtttactatgtgaagctg
actgaaatattttggatatcgtcaagtcatctttatcatgcatatgcatggttcaggctc
tttttattgcagaaaagcttcaataagaatctgagccagaaggatttgcaattaatagct
tcgtctgttgttctggctgcactttcagtgcctcctcatgaccgcacacatggtgcgtct
catttggaactggagcatgaaaaagagagaaatttgaggatggccaatctcattggcttt
aatcttgagactaaacctgaaagcagagaaatgctgtcaagatcatcacttcttgctgaa
ctggcatccaagggagtgatgtcttgtgtaactcaggaagtgaaagatgtttaccatctt
ttggaacatgaatttcatccctcagatcttgcattgaaagcgctgcccttgataactaaa
atctcaaagttagggggcaagctttctacagcttcttctgttccagaagtacaattgtct
caatatgtaccagcactggaaagactagctaccatgaggttgctgcagcaggtgtccaat
gtgtaccagacaatgaagattgagactttaactgggatgatcccattctttgacttttct
gtagttgaaaagattgctgtagatgctgtaaagcagaagtttgtatccatgaaggttgat
cacatgaaaaatgttgtgattttttgcaaaacgagtctcgagtctgatggtttaagggat
cacttggccaattttgctgaacaattaaataaggccaggcaaatgatttatcctcctgat
aggaaaccatctaaacttggagctttacttccaactttgacagaggttgttgccaaagaa
cacaagaggcttcttgctcgaaaatcaattattgagaagcggaaagaagaacaagaacga
cagcttcttgaaatggaacgggaggaggagtcaaaaagactaagacttcagaaaataaca
gaagaagcagaacaaagacggcttgcgacagagtatgagcagaggaagaatcagaggatc
ctcagagagatagaagaaagagaaattgaagaagctcaagctttactccaagaagctgaa
aaacgtattaaaaagaagggcaaaaagcctatcattgagggagacaaaatcactaagcag
accttgatggagttaactttgactgaacaactccgggaaaggcaggaaatggaaaagaag
ttgcagaagttagcaaaaacaatggattatttggaaagagcgaaaagagaagaggctgca
ccccttattgaagctgcatatcaacaacgtttagtggaagagagacttcttcatgagcgt
gaacaacagcaagaagttgaagttagcaaacagaggcatgagggagatctcaaagagaag
gagaggcttgcacgaatgatgggcaataaggagatatatgaggtccgagttgttagtcat
cgccaagcagagtttaatagattgagaagagaacgggaagagcgaatctctaggattttg
cagtcgaggagacaggagagggaaaaactgaggaagttgaagtattatctgaaattagaa
gaagagagacaacaaaaaatgcatgaggaggaggaagctcggaaacgtgaagaggctgaa
aggagaaagaaggaagaggctgaacgcttagcaaaactggccgaaatagctgaaaaacag
aggcagagagagcgggaactcgaggaaaaggagaaacaaaggagagaagcattgttaggc
agagctgctgaaccagctcctcctgctcgaccattggaatctgtaacagctcctgctgca
gcagctgcagccgctgctgctccaacccctgggaaatatgtgcctaagttcaggcgaact
gaaagaacaggaactgatcctcctccggaaacagaccgctggagtaacagtagcagcagc
aggcaggatggtgacaggtggcgtagtgatgataagagaactagttatgttgctggtggt
ggaggttcaaggtcatcttcttcttggtccaggaatccccgttga

DBGET integrated database retrieval system