KEGG   Phaseolus vulgaris (common bean): PHAVU_001G223300gHelp
Entry
PHAVU_001G223300g CDS       T03093                                 

Definition
(RefSeq) hypothetical protein
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
pvu  Phaseolus vulgaris (common bean)
Pathway
pvu00030  Pentose phosphate pathway
pvu00480  Glutathione metabolism
pvu01100  Metabolic pathways
pvu01110  Biosynthesis of secondary metabolites
pvu01200  Carbon metabolism
Module
pvu_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
pvu_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:pvu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PHAVU_001G223300g
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PHAVU_001G223300g
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pvu04147]
    PHAVU_001G223300g
Enzymes [BR:pvu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     PHAVU_001G223300g
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     PHAVU_001G223300g
Exosome [BR:pvu04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   PHAVU_001G223300g
  Exosomal proteins of colorectal cancer cells
   PHAVU_001G223300g
  Exosomal proteins of bladder cancer cells
   PHAVU_001G223300g
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-GeneID: 18642215
NCBI-ProteinID: XP_007163302
UniProt: V7D267
Position
1
AA seq 611 aa AA seqDB search
MSVSFSSTSLPFSESSFAFQRPPHLCSKVASNNFPSVTCGGRLALNVGGTSLCRRFRGFK
LWVLERLNSQFQSPKQPKNRIRFENNLENSGSSNEKGPLSDSSSILRVPDDKLTSMESPS
LLQTGLSATPMDVSRKPSLCISVIGATGELAKSKIFPALFALYYSGFLPEDVGIFGYSRK
DITDEDLRSIIASTLTCRVDHQENCVDKLDAFLSRTYHINGGYDNKYGMSMLNARMEQIE
GGSKTNRIFYLSVPQEAVLDVTACLSSSAQTQKGWNRIIFEKPFGFDALSSFRMTQYLLS
NFEEKQIYRIDHLLGRNLIENLTVLRFSNLVFEPLWSRTYIDNVQVILSEDLTKHPGRYF
SGYGIIRDIVHSHILQTIALLAMEPPVSLDGEDIRNEKVKVLRSIRKLEPKDVILGQYKA
SGGAKVDTCLNGLTPTYFAAALYIDNARWDGVPFFIKTGLGLIKHQMEIRIQFRNVPGNV
YRECMGHNMDRAVNELILRDVPDEAILVRVNNKVPGLGLQLDSSELNLLYKDKYNMEVPD
SYEQLLLDVIDGDNHLFMRSDELEAAWNILTPILNEIDKDNISVELYEMGGRGPVGAYYL
WAKHGVRWVED
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtgtctttctcgtcaacctcgcttccgttctccgaatcttcattcgcattccaa
agaccaccacatctttgctctaaagttgcatcaaataactttccctcagtaacctgtggt
ggtcgtcttgcactgaatgttggaggcacaagcttgtgtcgaaggtttcgtggcttcaaa
ctgtgggtacttgagagactcaactctcaatttcagtcaccaaagcaacctaagaataga
attcgcttcgaaaataatttggaaaattccggttcatcaaatgaaaagggaccactttct
gattcatcctcgattctccgtgttcctgatgataagctcacttccatggagtctccatct
ttgctgcagacaggtttgtctgctactcccatggatgttagcagaaaaccctcactttgc
atttctgtcataggagctaccggtgagctggcaaagagtaagattttccctgctttattt
gccctctactacagtggctttcttcctgaggatgtaggcatttttgggtattcaaggaag
gatataacggatgaagacctgcgatctattatagcttcaacattaacatgccgagttgat
catcaagagaattgtgtggacaaattagatgctttccttagtagaacatatcatattaat
ggaggctatgacaataaatatgggatgtccatgctcaatgcccgaatggaacaaattgag
ggaggatccaaaaccaacaggatattctacctttctgtgccacaagaagcagttttagat
gttacggcttgtctttctagcagtgctcagactcaaaagggatggaatcgcataatattt
gagaagccatttggctttgatgcactttcttcctttaggatgacacaatatctactttca
aactttgaggaaaagcaaatatataggattgatcatcttctaggaaggaatctcattgaa
aatctcacagttttaaggttttcaaatctagtttttgagccactttggagtcgtacttac
atagacaatgtacaggtcattttatcagaggacctgaccaagcatccaggaagatatttc
agtggctatggcattatccgtgatattgttcatagtcacattctccaaacaattgcattg
cttgccatggaaccaccagtaagccttgatggagaagatattcgaaatgaaaaggtcaag
gttttgaggtcaattcgcaaattggagcctaaggatgtcattcttgggcaatataaagca
agtggtggagccaaagttgatacatgcttaaatggtctgacacctacttattttgctgct
gcactatacattgacaatgcacgatgggatggtgtgccgttttttattaaaacaggcttg
ggactcatcaaacaccaaatggagatacggattcaatttcgaaatgttccgggtaatgtg
taccgtgagtgcatggggcataacatggaccgtgctgtaaatgagctcattctccgtgat
gttccggatgaggctattctggtgagagttaacaacaaggttccaggactaggcttgcaa
ctggactcttcagaactaaatttgctttacaaggacaagtacaacatggaggttccagat
tcgtatgagcaacttcttcttgatgtcattgatggggacaaccatttgtttatgagaagt
gatgaacttgaagctgcatggaacattctaactccaattctgaatgagatcgacaaagac
aatatatcagtggagctttatgagatggggggtcgaggtcctgtgggggcatactacctt
tgggcaaaacatggtgtccgttgggtagaggattaa

DBGET integrated database retrieval system