KEGG   Phaseolus vulgaris (common bean): PHAVU_002G281900gHelp
Entry
PHAVU_002G281900g CDS       T03093                                 

Definition
(RefSeq) hypothetical protein
  KO
K03428  magnesium-protoporphyrin O-methyltransferase [EC:2.1.1.11]
Organism
pvu  Phaseolus vulgaris (common bean)
Pathway
pvu00860  Porphyrin and chlorophyll metabolism
pvu01100  Metabolic pathways
pvu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pvu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PHAVU_002G281900g
Enzymes [BR:pvu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.11  magnesium protoporphyrin IX methyltransferase
     PHAVU_002G281900g
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mg-por_mtran_C Methyltransf_25 Methyltransf_23 Methyltransf_12 Methyltransf_31 Methyltransf_11 MTS PrmA Ubie_methyltran Methyltransf_32 CMAS Methyltransf_18 Methyltransf_9
Motif
Other DBs
NCBI-GeneID: 18639371
NCBI-ProteinID: XP_007159960
UniProt: V7CRR1
Position
2
AA seq 324 aa AA seqDB search
MAFSSSLWSSLIVPNPNRTTSLPRFSHKPHKLPLSPAFAIPPLSTATAADVSGAIDGTTV
AVVSGGFVAALAAVLSLTDPERRRQLQAEEVGGGDKEVVREYFNNSGFQRWKKIYGDTDE
VNRVQRDIRLGHAKTVENTLNMLKDEGSLQGVTVCDAGCGTGSLSIPLAKEGAVVFSSDI
SAAMVAEAEKQAKEQLVADGNGSAPVLPKFVVKDLESLDGKYDTVICLDVLIHYPQSKAD
GMIGHLASLANNRLILSFAPKTFYYDILKRIGELFPGPSKATRAYLHSEADVERALKKVG
WTIRKKGLITTQFYFAKLIEAVPM
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggcgttctcgtcgtccctgtggtcttcactcatcgttccaaaccctaacagaaccacc
agtctccctcgattttctcacaaaccgcacaaactcccgctatcgccggcatttgccatc
ccgccgctctcgacggccaccgcggccgatgtctcgggtgctatcgatggtaccacggtc
gcggtggtgagcggggggttcgtggcggcgctggcggcggtgctgtcgctgacggacccc
gagcggcggcggcagttgcaggcggaggaggtgggcggaggagacaaggaggtggtgagg
gagtacttcaacaactccgggttccagcggtggaagaaaatctacggtgacacggacgag
gtgaaccgtgttcagcgcgacattcggttgggacacgcgaagaccgtggagaacacgctg
aacatgttgaaggacgaagggtcgcttcagggcgttacggtttgcgacgctgggtgtggg
accggttcgctatcgattcctctcgcgaaagagggcgctgtcgtgttctccagtgatata
tccgctgccatggttgctgaagctgagaaacaggcaaaagaacaacttgtagccgatgga
aatggatctgcccctgtgttgccaaagtttgtagtgaaggatttagagagtttggatgga
aagtatgacactgtgatctgccttgatgttttgattcattaccctcaaagtaaagctgat
gggatgatcggtcaccttgcgtcattggccaacaaccgattgattctgagttttgctccg
aagacgttttattatgatatactaaagaggattggagagttgttccctggtccttcaaag
gcaacaagggcatatcttcactccgaagcagatgttgaaagagcattgaaaaaggttggc
tggaccataaggaagaaaggcttaatcactactcaattttactttgctaagcttattgag
gctgttcctatgtag

DBGET integrated database retrieval system