KEGG   Phaseolus vulgaris (common bean): PHAVU_003G078700gHelp
Entry
PHAVU_003G078700g CDS       T03093                                 

Definition
(RefSeq) hypothetical protein
  KO
K15450  tRNA wybutosine-synthesizing protein 3 [EC:2.1.1.282]
Organism
pvu  Phaseolus vulgaris (common bean)
Brite
KEGG Orthology (KO) [BR:pvu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pvu03016]
    PHAVU_003G078700g
Enzymes [BR:pvu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.282  tRNAPhe 7-[(3-amino-3-carboxypropyl)-4-demethylwyosine37-N4]-methyltransferase
     PHAVU_003G078700g
Transfer RNA biogenesis [BR:pvu03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    PHAVU_003G078700g
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Met_10 Kelch_1 Kelch_4 Kelch_2 Kelch_3 Kelch_5 Kelch_6 MTS Cons_hypoth95 Chlorosome_CsmC DNA_methylase DUF1668 Methyltransf_15
Motif
Other DBs
NCBI-GeneID: 18634229
NCBI-ProteinID: XP_007153946
UniProt: V7C9J0
Position
3
AA seq 745 aa AA seqDB search
MGRHARRNDLLLLDPYSGNLEMVSTVGCASPTPRLGHTASLVGNCMFVIGGRTGPDKILS
DVWILDTTMNSWKLLQCSDNLFLPRHRHAAAIMGSDIYVFGGLDNDTIFSSFYVFDTNTL
HWKEIPVSGDWPCARHSHAMVASDSQIFMFGGYNGGKALGDLYSFDVQKGQWTKERTTGR
NPHARFSHSIFVHKNYLGVLGGCPVRQHCEELALLDLKLRLWKHVTLNSVGKDLFVRSTT
NVVGDDLVIVGGGASCYAFGTKFSEPAKVNLLHIIHSHDEHMSVKNQSKHVINQDEGTIG
NNIKNSCQPQLELGPNVFEDESLCFNDNLPCLNDQSQMIASHYILQLKKKYAKLGKDILK
KFGWLDLGRKAHSEEGGVHICFPVHQEFFAVFCERNHHLRDASNGKNEVPFSKPLKQDEY
LLNELSYSEALTILHEYGAIILEDKVVEERKTAKSPLKVMTEAVTSLIKHKGLPTRLLEE
LPTRWDRLGDIIILPISSFKDSMWDSIAGELWPIVAKSLKAHRLARQGPVAATGTRDSTL
QILVGDSGWVNHRENGVFYSFDATKCMFSWGNLSEKIRMASLDCKEEVVVDLFAGIGYFV
LPFLVRAQAKFVYACEWNPHAVEALRHNLQANSVADRCIILEGDNRITAPRGVADRVCLG
LIPSSELSWITAVRALRREGGMLHVHGNTKDSEESEWIDRVAKSINDIARSEGYCWEISV
EHVERVKWYAPHIRHVVVDVRCRQI
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atggggagacatgccagaagaaatgatttgttgctgcttgatccatattctggcaatctt
gaaatggttagcactgttggttgtgcttctccaactccacgattgggccatacggcttct
ttggttggaaattgcatgtttgtgattggaggtcggactggtcctgacaaaattctcagt
gatgtatggatcctagatacaacaatgaattcttggaagttactgcaatgtagtgacaat
ttatttcttcccaggcatcgtcatgctgcagctatcatgggttctgacatttatgtattt
gggggtcttgataatgatactatcttttcttccttttatgtttttgacacaaacacttta
cactggaaagaaataccagtttctggtgactggccatgtgcgcgtcactcacatgctatg
gtggcatctgattctcagattttcatgtttggtggatacaatggtgggaaagcacttggg
gatttgtatagttttgatgttcagaagggtcaatggacaaaggaaaggacaactggaagg
aatccacatgccagattctcccattcaatttttgtccataagaattatcttggagttctt
ggtggttgtcctgttaggcaacactgtgaagagttggctttacttgatttgaagcttcgt
ctatggaagcatgtaacactcaattctgtaggtaaagatttgtttgtgcgtagtacaacc
aatgttgttggtgatgatcttgtcatagttggtggtggtgcatcatgctacgcatttggg
acaaagttcagtgagcctgcaaaagtcaacttgctccatataatccattcacatgatgaa
catatgtctgtcaaaaatcaaagcaaacatgtgattaaccaagatgaagggacaatcggg
aataacattaaaaattcatgtcaaccccaacttgaacttggaccaaatgtatttgaagat
gaaagtttatgttttaatgataacctaccctgcttgaatgatcaaagtcagatgattgca
tcgcattatattttgcaactgaaaaagaaatatgcaaaattgggaaaggatatattgaag
aaatttggatggttagacttagggaggaaggcacactctgaagagggtggagtacatatc
tgttttcctgtccatcaagaatttttcgctgtattttgtgaaaggaatcatcatttgcga
gatgcatcaaatggaaaaaatgaagttcccttttcaaaaccacttaaacaagatgaatac
ttgttaaatgagttatcctattctgaagcattgaccattctccatgagtatggtgcaatt
attcttgaagacaaggttgttgaagaaagaaaaactgccaaatctcctttaaaagtgatg
accgaagcagtaacatctttgattaagcataaaggcctaccaacgcggcttctagaggaa
cttcctacaagatgggatcggcttggagatattattatacttccaattagttcttttaag
gattccatgtgggactccattgcaggagagctttggcccattgttgccaaatcactcaag
gctcaccgtctagctcgccagggcccagttgctgcaactggtacaagagatagtacattg
cagattcttgttggagatagtggctgggttaatcatcgagaaaatggagtattctattct
tttgatgctacaaaatgcatgttttcatggggtaatctttctgagaaaatccggatggcc
agtctggattgtaaagaggaggttgtagtagacctttttgcgggcattggctactttgtg
cttcctttcctcgtcagggcccaggcaaaatttgtatatgcttgtgagtggaatccccat
gcagtagaagcactacgacataatctccaagcaaattctgtggctgatcgttgtatcata
cttgaaggagataatcgcattaccgctcccaggggtgtggctgatagagtttgtctaggt
ctcattccatctagtgagcttagctggatcacagcagtgagggctttaagaagagagggt
ggaatgttacatgtccacgggaatacaaaagactcagaggagagtgagtggattgatcgt
gtggcaaaatcaataaatgacattgctagatcggaaggttattgttgggagatttctgta
gaacatgttgagagggtaaaatggtatgctccacatattcgtcacgttgtagtggatgta
agatgcagacagatctaa

DBGET integrated database retrieval system