KEGG   Phaseolus vulgaris (common bean): PHAVU_003G207100gHelp
Entry
PHAVU_003G207100g CDS       T03093                                 

Definition
(RefSeq) hypothetical protein
  KO
K17890  autophagy-related protein 16-1
Organism
pvu  Phaseolus vulgaris (common bean)
Pathway
pvu04136  Autophagy - other
Brite
KEGG Orthology (KO) [BR:pvu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04136 Autophagy - other
    PHAVU_003G207100g
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pvu04131]
    PHAVU_003G207100g
   03029 Mitochondrial biogenesis [BR:pvu03029]
    PHAVU_003G207100g
Membrane trafficking [BR:pvu04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    PHAVU_003G207100g
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    PHAVU_003G207100g
Mitochondrial biogenesis [BR:pvu03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    PHAVU_003G207100g
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ATG16 ANAPC4_WD40 Nup160 PQQ_2 Cytochrom_D1 Cep57_CLD_2 Phage_GP20 DUF2935 DUF1664 Sigma_1s Phlebovirus_NSM
Motif
Other DBs
NCBI-GeneID: 18635551
NCBI-ProteinID: XP_007155503
UniProt: V7CBB8
Position
3
AA seq 514 aa AA seqDB search
MAKTCKSQEEIACEAIKHALKALRKRHLLEEAAHGPAVLALSRPIASQGSEWKEKAENLQ
VELQQCYKAQSRLSEQLVVEVAESRTSKALAQEKENAVADLQKELTELRDECSQLKEDLE
EKIKSLEMIVSENSELKAQLQQMTTKANKAEAENKMLIDRWMLEKMKDAERLNEANALYE
DMVEKLKASGLEQLARQQVDGIVRQSEEGAEFFLESSIPSTCKYRLRAHEGGCASMLFEY
NSSKLITGGQDRLVKMWDTNTGSLSSTLHGCLGSVLDLTITHDNRSVIAASSSNNLYVWD
VNSGRVRHTLTGHTDKVCAVDVSKISSRHVVSAAYDRTIKVWDLVKGYCTNTIIFPSNCN
ALSFSMDGQTIFSGHVDGNLRLWDIQSGKLLSEVAAHSLAVTSISLSRNGNIVLTSGRDN
LHNLFDVRSLEVCGTLKATGNRVASNWSRSCISPDDNHVAAGYADGSVYIWSISKGDIVG
TLKEHTSSVLGCTWSGVGKPLASADKNGIVCVWT
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaaacatgcaagtcgcaagaagaaattgcgtgtgaagctattaaacatgctttg
aaggcactacggaagcgccatttgcttgaagaagccgctcatggtcccgctgttctagct
ctttctagacccatcgcttctcagggctctgagtggaaagagaaagcagagaatcttcaa
gtggaacttcagcaatgctacaaagcacaatctaggctgtctgagcagcttgttgtggaa
gtagctgagtccagaacttcaaaagcgttggctcaagagaaagaaaatgcagttgctgat
ttgcaaaaggaattgactgaattgagggatgagtgttctcagttaaaggaagacttggaa
gaaaagattaaatctctagaaatgattgtcagtgagaattctgaacttaaagcccaactg
cagcagatgactactaaagccaataaagctgaagctgaaaataagatgttgatcgaccgc
tggatgttggaaaagatgaaggatgctgaacgcctgaatgaggccaacgcactgtatgaa
gacatggtcgagaaactaaaggccagtggcttagagcaacttgcaaggcagcaggtggat
ggtatagttcgccaaagtgaagaaggtgctgaattttttttagagtcaagcatcccttcc
acatgtaaatacaggcttcgtgcacatgaaggtggttgtgcttccatgttgtttgagtac
aattccagtaaactgatcactgggggacaggatcggttagttaaaatgtgggatacaaat
acaggatccttatcttctactcttcatggctgccttggctcagtattagatctcacgatc
acccatgataatcgatctgtcattgctgcaagcagctcaaacaacttgtatgtatgggat
gtcaactccggccgtgtccgtcatacccttactggccacacagataaagtttgtgctgtt
gatgtgagcaagatttcaagtcgtcatgttgtcagtgctgcttatgatcgtaccataaaa
gtttgggacctagtgaaaggttactgcactaacacaatcatttttcccagcaactgcaat
gctctctccttcagcatggatggtcagaccatattttcaggacatgttgatggtaatctt
cggttatgggacattcaaagcggaaagctactcagcgaggttgctgcacattcacttgcg
gtcacatcaatatccctttctcgaaatggaaatattgtactgaccagtggaagggacaac
ttgcacaatttgtttgacgtgcgatctcttgaagtttgtggcacactaaaagcgacggga
aacagagttgcttctaactggagccgctcctgtattagtccagatgacaatcacgttgct
gctgggtatgccgatggatctgtctatatttggtcaatttctaaaggtgatatagtcggt
acactcaaggaacacacttcttctgttctgggttgtacgtggagcggggttggaaaaccg
ctggcctcagctgacaagaatgggatagtttgtgtctggacataa

DBGET integrated database retrieval system