KEGG   Phaseolus vulgaris (common bean): PHAVU_003G208500gHelp
Entry
PHAVU_003G208500g CDS       T03093                                 

Definition
(RefSeq) hypothetical protein
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
pvu  Phaseolus vulgaris (common bean)
Pathway
pvu00230  Purine metabolism
pvu00240  Pyrimidine metabolism
pvu01100  Metabolic pathways
pvu01110  Biosynthesis of secondary metabolites
pvu04016  MAPK signaling pathway - plant
Module
pvu_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
pvu_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
pvu_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:pvu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    PHAVU_003G208500g
   00240 Pyrimidine metabolism
    PHAVU_003G208500g
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    PHAVU_003G208500g
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pvu04131]
    PHAVU_003G208500g
Enzymes [BR:pvu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     PHAVU_003G208500g
Membrane trafficking [BR:pvu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    PHAVU_003G208500g
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NDK HTH_Tnp_IS1
Motif
Other DBs
NCBI-GeneID: 18635565
NCBI-ProteinID: XP_007155518
UniProt: V7CBD1
Position
3
AA seq 227 aa AA seqDB search
MEGVCGRGVCVTASLPRSARLTRSSVPVYRVSYEHLTPFPSQSHLFSYQSPPYAKTLRAR
NTTKPAIFLPHLIASLQQVDQAYIMVKPDGVQRGLVGEIISRFERKGFKLTGLKLFQCSK
ELAEEHYKDLKQKSFFPKLIDYITSGPVVSMAWEGVGVVASARKLIGATDPLQAEPGTIR
GDLAVQTGRNVVHGSDSPENGKREIALWFKEGELCEWTPVQAPWLRE
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggaaggtgtgtgtggaaggggggtttgcgtcacagcatctcttccgcgctcagcaagg
cttaccagaagcagtgttcctgtgtaccgagtcagttacgaacacctaacaccatttcct
tcacaatcccatctattctcgtatcaatctccaccctatgccaaaaccctccgcgccaga
aacactaccaaacccgctattttccttccccacttaattgcttctctgcaacaagttgac
caggcatacataatggtgaagcctgacggcgtgcaacgtggcctcgtgggagaaattatt
tctaggtttgagaggaaggggtttaagttgactggcttgaagctcttccagtgctctaaa
gaattggctgaggagcattacaaggacctaaaacaaaagtcattcttccccaagctcatt
gactatattacttcaggtcctgttgtttctatggcttgggagggtgttggagtagtggca
tccgcacgtaagcttataggggctactgatcctcttcaagctgaaccaggcacaataaga
ggagaccttgctgttcaaacaggaaggaatgttgttcatggcagtgacagtcctgagaat
ggcaagcgtgaaatagctctatggttcaaggaaggcgaattatgcgaatggacccctgtt
caagcaccgtggcttagagaataa

DBGET integrated database retrieval system