KEGG   Phaseolus vulgaris (common bean): PHAVU_003G209100gHelp
Entry
PHAVU_003G209100g CDS       T03093                                 

Definition
(RefSeq) hypothetical protein
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
pvu  Phaseolus vulgaris (common bean)
Pathway
pvu00620  Pyruvate metabolism
pvu00630  Glyoxylate and dicarboxylate metabolism
pvu01100  Metabolic pathways
pvu01110  Biosynthesis of secondary metabolites
pvu01200  Carbon metabolism
Module
pvu_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:pvu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PHAVU_003G209100g
   00630 Glyoxylate and dicarboxylate metabolism
    PHAVU_003G209100g
Enzymes [BR:pvu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     PHAVU_003G209100g
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-GeneID: 18635571
NCBI-ProteinID: XP_007155524
UniProt: V7CDS3
Position
3
AA seq 522 aa AA seqDB search
MEFGTYGSYYDVPEGVDIRGRYDAEFAKILTKDALKFVAELQREFRNHIKYALERRREAK
RRYNEGALPGFDPATRYIREQEWVCAPVPPAAADRKVEITGPVERKMIINALNSGAKVFM
ADFEDALSPSWENVMRGQVNLKDAVDGTISFHDKVRNRVYKLSDDTAKLFVRPRGWHLPE
AHIFIMVNLQPVALEAKIWNSVFEKAENVAGIERGSIRATVLIETLPAVFQMNEILYELK
EHSVGLNCGRWDYIFSYVKTFQAHPDRLLPDRVQVGMTQHFMKSYSDLLIRTCHRRGVHA
MGGMAAQIPIKEDPVANELALELVRKDKLREVNAGHDGTWAAHPALIPACMEVFNNKMGN
APNQIHTNKREDAENITEQDLLQVPRGSRTMEGLRLNTRVGIQYVAAWLSGSGSVPLYNL
MEDAATAEISRVQNWQWLKYGVEVNGDEVGVKVNREVFGRVVEEEMARIEKEVGREKFRK
GMYKEACKIFTRQCTSPTLDDFLTLDAYNYIVLHHPKESSKL
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atggagtttggaacctatggctcttactatgatgtgccagagggagtggatattcgggga
agatatgatgcagagtttgcaaaaatcctgacaaaagatgctttgaaatttgttgctgag
cttcaacgtgagttcaggaaccatataaagtatgcattagagaggagaagagaggcaaag
aggaggtacaatgaaggggctcttccggggtttgatcctgccaccaggtacataagagag
caagagtgggtgtgtgcacctgttccaccagctgctgctgataggaaagtggaaatcact
ggtccagtggaaagaaagatgatcatcaatgctctcaactctggtgctaaagtctttatg
gctgattttgaagatgcactgtcacccagctgggaaaatgttatgagagggcaagtgaac
ttgaaggatgctgttgatgggaccataagctttcatgacaaagtaagaaacagggtttac
aagctcagtgatgacacagcaaagctttttgtgcgaccaagaggttggcacctacccgag
gcacatatattcattatggtgaacctgcaaccggttgccttggaagctaagatatggaac
agcgtgtttgagaaggctgagaatgtagcaggcatcgaaagaggaagcataagggcgacg
gttctgatagaaacacttcctgcagtgtttcagatgaatgaaattctgtatgagctgaag
gagcactcggtgggtctgaactgtgggcgatgggattacattttcagttatgtgaagacc
ttccaagctcacccagatcgcctcctaccagatagggtgcaggttggcatgactcagcac
ttcatgaagagttactctgatctcctcatcaggacctgccacaggcgcggtgtgcacgct
atgggaggaatggccgcgcagattccaatcaaagaggacccagtggctaatgagttagca
ctggaacttgtgaggaaggacaagcttagagaagtgaatgcagggcacgatgggacttgg
gctgcacaccctgctctcattccagcttgcatggaggttttcaacaacaaaatgggcaat
gctcctaaccagatacatacaaacaaacgtgaagatgctgaaaacataaccgagcaagac
ctattgcaggtaccaagaggatcccgcaccatggaaggtctcagattgaacacaagggtg
gggattcagtacgtggcagcatggctgagtggaagcggttctgtgccgctttacaacctg
atggaagatgctgcgactgctgagattagccgggtgcagaactggcagtggctcaagtat
ggtgtggaagtgaatggggatgaagttggagtgaaagtgaacagagaagtttttggtagg
gtggttgaagaagagatggcaaggattgagaaggaagtgggaagagagaagttcagaaag
gggatgtataaggaggcttgcaagatcttcacacgccaatgcacctccccaacacttgat
gattttcttactctggatgcctataattacatagtcctgcatcaccccaaggaatcatca
aaactttga

DBGET integrated database retrieval system