KEGG   Phaseolus vulgaris (common bean): PHAVU_003G246400gHelp
Entry
PHAVU_003G246400g CDS       T03093                                 

Definition
(RefSeq) hypothetical protein
  KO
K05864  peptidyl-prolyl isomerase D [EC:5.2.1.8]
Organism
pvu  Phaseolus vulgaris (common bean)
Brite
KEGG Orthology (KO) [BR:pvu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:pvu03110]
    PHAVU_003G246400g
Enzymes [BR:pvu01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     PHAVU_003G246400g
Chaperones and folding catalysts [BR:pvu03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    PHAVU_003G246400g
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase TPR_1 TPR_2 TPR_11 TPR_8 TPR_7 TPR_14 TPR_12 TPR_6 TPR_19 MIT TPR_16 TPR_17
Motif
Other DBs
NCBI-GeneID: 18635949
NCBI-ProteinID: XP_007155953
UniProt: V7CCM4
Position
3
AA seq 360 aa AA seqDB search
MVNPKCFLDISIAGELEGRVVIELFHDLVPKTAENFRALCTGEKGIAPNTNVPLHYKGVC
FHRVIKGFMIQGGDISAGDGTGGESIYGLKFEDENLDLKHERKGMLSMANAGPNTNGSQF
FITTTRTPHLDGKHVVFGRVVKGMGVVRSAEHVVTGENDRPTQTVVIEDCGEIPEGQDDG
VVNFFNDGDTYPDWPADLDVKPDELSWWTSAVDSIKALGNEQYKKQDYKMALRKYRKALR
YLDVCWEKDDIDQENSASLRKTKSQIFTNSSACKLKIGDLQGALLDSDFAMHDGDNAKAL
FRKGQAYMLLNDLDSALESFKKALELEPNDGGIKKEYATARKKVADRRDREKQAYSKMFK
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaccctaaatgttttttggacattagcatcgccggcgagttagagggcagagtc
gtcatcgaactcttccacgacttggttcccaaaactgcagagaatttcagggccctttgc
actggggaaaagggcatagcacccaacaccaatgtccccctccactataagggcgtatgt
ttccaccgtgtgatcaaagggttcatgatccaaggtggcgacatctctgctggcgacggc
acaggaggggaatccatatacggcctgaagtttgaggacgagaacttggacctgaagcac
gagaggaaggggatgctttccatggccaatgcaggacccaataccaacggttctcagttt
ttcatcaccaccacacgcacccctcacttggacggtaaacacgtggtgttcggaagagtt
gttaaaggaatgggtgttgttcgctccgccgaacacgttgttactggtgagaacgaccgt
ccaactcagactgttgtaatagaggattgtggggaaattcccgaagggcaagatgatgga
gttgttaacttctttaatgatggtgacacttatcctgattggcctgctgatcttgatgtc
aaacctgatgaactttcttggtggacgagtgctgtggactctatcaaggctctggggaat
gagcagtacaagaagcaagattataagatggcattgagaaagtatcgcaaagcgttgcgc
tatttggatgtgtgttgggagaaggacgacattgaccaagagaacagtgcttcattaagg
aagacaaaatctcaaatatttaccaatagttctgcttgtaaattgaaaataggagatcta
caaggagcgctactggattcagactttgcaatgcacgatggagataatgcaaaagctctg
tttcgaaaaggccaggcatatatgttactcaatgacctggattcagctcttgaaagcttc
aagaaagcattagagttggagcctaatgatggagggattaaaaaggagtatgccactgcc
aggaagaaggttgctgatagacgcgatagagagaaacaggcttattctaaaatgttcaag
tag

DBGET integrated database retrieval system