KEGG   Phaseolus vulgaris (common bean): PHAVU_004G050500gHelp
Entry
PHAVU_004G050500g CDS       T03093                                 

Definition
(RefSeq) hypothetical protein
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
pvu  Phaseolus vulgaris (common bean)
Pathway
pvu00460  Cyanoamino acid metabolism
pvu00500  Starch and sucrose metabolism
pvu00940  Phenylpropanoid biosynthesis
pvu01100  Metabolic pathways
pvu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pvu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PHAVU_004G050500g
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    PHAVU_004G050500g
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    PHAVU_004G050500g
Enzymes [BR:pvu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     PHAVU_004G050500g
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_3 Glyco_hydro_3_C
Motif
Other DBs
NCBI-GeneID: 18632071
NCBI-ProteinID: XP_007151483
UniProt: V7BZX2
Position
4
AA seq 628 aa AA seqDB search
MAKLSISVVGIMLLHCWVAINEAKYLKYKDPKQPLNVRIKDLMKRMTLEEKIGQMTQIER
KVASAEIMKNYYIGSVLSGGGSVPKAQASAEDWINMVNDFQKGSLSTRLGIPMIYGIDAV
HGNNNVYNATIFPHNVGLGATRDPGLVRRIGAATALEVRATGIQYAFAPCIAVCRDPRWG
RCYESYSEDHKVVQAMTEIIPGLQGEIPTNSTKGVPFVAGKRKVIASAKHYVGDGGTKNG
INENNTVISRHGLLSIHMPAYYDAIIKGVSTVMVSYSSWNGEKMHANHNLITDFLKNSLR
FRGFVISDWEGIDRITTPPHANYTYSIYAAITAGIDMVMVPLNYTEFIDGLTSLVKVNAI
PMSRINDAVRRILRVKFIMGLFENPLADHSLVHELGRKKHRKLAREAVRKSLVLLKNGEN
PNQPLLPLPKRASKILVAGSHADNLGYQCGGWTIEWQGVTGNNVTKGTTILSAIKNTVHK
DTEVVYKENPDLDFIKSNNFSYGIVVVGEKPYAETNGDSLNLTISAPGPETIKNVCGGVK
CVTVIISGRPVVIQPYVDKIEALVAAWLPGTEGKGVTDVLFGDYGFRGKLPRTWFKTVDQ
LPMNVGDSHYDPLFPFGFGLKTKPHKAN
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaactcagcatctctgtggtggggattatgctcctgcattgttgggtagccata
aacgaggcaaagtacttgaaatataaagatccaaagcagcctctgaatgttcgaatcaag
gatctcatgaagagaatgactttagaggagaaaatcggtcaaatgacacagattgaacgt
aaagttgcttctgcagaaatcatgaagaactattatattgggagtgtgctaagtgggggt
ggcagtgttccaaaggctcaagcttctgcagaggattggattaacatggtgaatgatttt
caaaagggttctttatcaactagattgggaattcctatgatatatgggatcgatgctgtt
catggcaataataatgtatataatgcaacaatttttcctcacaatgttgggctaggtgct
accagggaccctggacttgtgaggagaattggagcagcaactgctcttgaagttagagct
actggaattcaatatgcctttgcaccttgcatagcagtttgtagagatcctaggtgggga
agatgttatgaaagttatagtgaagaccacaaagtagttcaggctatgactgagattatt
ccaggtctgcaaggtgaaattccaacaaactcaacaaaaggtgttccatttgttgctgga
aagcgaaaagttatagcctctgcaaagcactatgttggggatggaggaaccaaaaatgga
atcaatgagaacaacacagtgataagcagacatggattgcttagcattcacatgccagcc
tattatgacgcaatcatcaagggtgtttcgactgtcatggtctcttattcaagctggaac
ggagaaaaaatgcatgccaatcataatctaatcacagactttctcaagaactctctacgc
tttaggggttttgtcatatctgattgggagggaattgatagaatcaccacacctcctcat
gctaactacacgtattccatttatgctgcaatcactgctggaattgacatggtaatggtt
ccccttaactacacagaattcatagatggcctaacctcattggtgaaagttaatgccata
ccaatgagcagaattaatgatgcagtaaggagaattttgagggtaaagttcattatgggc
ctttttgagaacccattggctgatcatagcctagttcacgagctcgggaggaagaaacat
cgaaaattggctcgggaagctgtgaggaaatccttggttctattgaagaatggtgaaaat
cctaaccaaccacttctccctcttcctaaaagagcttcaaagatattggtggctggaagc
catgctgataatctaggatatcaatgtggtggttggacaattgaatggcaaggagttact
ggaaacaatgtcaccaaaggtacaacaatccttagtgctataaaaaatacagtccataaa
gataccgaggtagtttacaaggagaatcctgatttggacttcattaagtctaataatttt
tcatatgggattgtggtagtcggagagaaaccatatgctgaaacaaatggtgatagcttg
aatttgacaatatctgcacctgggccagaaaccataaagaatgtatgtggaggagtcaaa
tgtgttactgtaataatctctggtcgtcctgtggttatacaaccatatgttgacaaaatt
gaagcattggttgctgcttggcttcctggtaccgagggaaaaggtgtgactgatgttttg
tttggtgactatggctttagaggcaagcttccaaggacatggttcaagactgttgatcag
ttgccaatgaatgtaggagatagtcattatgacccccttttcccctttggatttggcctt
aaaactaaaccccacaaagccaattag

DBGET integrated database retrieval system