KEGG   Phaseolus vulgaris (common bean): PHAVU_005G022900gHelp
Entry
PHAVU_005G022900g CDS       T03093                                 

Definition
(RefSeq) hypothetical protein
  KO
K14759  isochorismate synthase / 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase / 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase / O-succinylbenzoate synthase [EC:5.4.4.2 2.2.1.9 4.2.99.20 4.2.1.113]
Organism
pvu  Phaseolus vulgaris (common bean)
Pathway
pvu00130  Ubiquinone and other terpenoid-quinone biosynthesis
pvu01100  Metabolic pathways
pvu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pvu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    PHAVU_005G022900g
Enzymes [BR:pvu01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.9  2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase
     PHAVU_005G022900g
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.113  o-succinylbenzoate synthase
     PHAVU_005G022900g
   4.2.99  Other carbon-oxygen lyases
    4.2.99.20  2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase
     PHAVU_005G022900g
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.4  Transferring hydroxy groups
    5.4.4.2  isochorismate synthase
     PHAVU_005G022900g
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPP_enzyme_N Abhydrolase_1 MR_MLE_C Abhydrolase_6 TPP_enzyme_M_2 Hydrolase_4 TPP_enzyme_C Ndr Abhydrolase_2 BAAT_C Abhydrolase_3 Thioesterase TPP_enzyme_M Esterase DUF676 Lipase_3
Motif
Other DBs
NCBI-GeneID: 18629835
NCBI-ProteinID: XP_007148889
UniProt: V7BV30
Position
5
AA seq 1692 aa AA seqDB search
MILAVSPLGRWRVCNSQMFTLQTAANNFGIGMPTANAATRTRSQATGVSGVRFDGPVPLN
GDVLEKEVLFEQCVTRTLSPALTLEEGLEKLKDALHTLKLQRPPSSTGFLRFQLAVPPSS
KAFSLFCSQPLSSSVFPLVYLSKTNADSKSLYVNGTRGVCAVGAAVSFLPPTSDHRTFVN
RYVSSDSANVMAYGFMDVNLDDGNVSHQEGSFWFFIPQIELDELESVSILSMTLAWDDFS
HSTFQEAYYLLEISLDQVMCHVWSTIDKWKSKCIRGALRKLNLVEDRSIPRVYMNTIAPG
GRECLSDIMELKESPSSSQFCFRLSATLAVSNNMLDHANELPYSLKESANINAVWASLIV
EECTRLGLMYFCIAPGSRSSPLAVAAASHKLVTCISCFDERSLAFHAVGYGRGSHIPAVV
ITSSGTAVSNLLPAVVEASQDFVPLVLLTADRPPELLDCGANQAIDQVNHFGSFVRFFFN
LPAPTDQIPAKMVLTTLDSAIHRATSSPCGPVHINCSFREPLESSPCKWLSSCLTGLDFW
MTNAEPFTKYLHMRLSHTSSSNAPGEMSEVLDLIQRSKNSLLLFGAIHTEDEMWAALLLA
KHLQWPVVADILSGLRLRTLLCSFPDIERNFMFVDNLDHVLLSDTVKGWLDVDVVIQIGS
RLTSKRVCQILEDRAPFSYIMVDTHPHRHDPSHIITHRLQTSIFEFVGCLLKASVSHTRS
MWSISLQLLSKMVEWEIKFQITAECSLTEPYVAHVMSEALTSESALFLGNSMPIRDANLY
GRSWSMCNQSVSSIMLNSDLPINLVRVAANRGASGIDGLLSTAIGFAEGCNKKVLCVVGD
ISLLHDTNGLAILNQRKFRKPMTILVVNNHGGAIFSNLPLADKVETSIMHEYFYTSHNIS
IRELCMAHGIKHLHVTTKEELKEALCVGQHEQTDCMIEIESSIDANASFHSILKKFALQT
AQDTMSYLSWVFNEGSVHDEFCLYKIRKIQCSKYRIALEAPPTSAFVGNSKELYKEGFIL
SLELEDGSVGYGEVAPIHIHRENLVDAEYQLRFLIHVMEHVDVSCFLSLLKGSFSYWIWH
ELGIMPSSIFPSVRCGLEMAILNAIADAKGSNMLNVLHPSINENNKCERSLNVQICALID
SNGSPAEVANVAAKLIEEGFSAIKLKVARRGDPMLDAAIIQEVRKKVGCQIIIRADANRN
WTYEEAMKFSSLVKDCNLQYIEEPVQDEDNILKFCEESGLSIALDETIDSMQENPMEKLV
KFTHPAISAVVIKPSVVGGFENAALIAQWAYHMGKMVVVSSAFESSLSLSAYTQFSSYLE
ILSLGKLKVLDNVPAPTIAHGLGTYRWLKEDVTPNPLSICRNPQSGFVEASVASASRYVR
DFQVDKKVVSYVIVQEQVRRYQCRVELNNVSCSFEVRETGHIANDNVLVFLHGFLGTGED
WINIMKTFSGSAKCISVDLPGHGKSILHGLEGVGEEPWLSLETIADILHKLIHHIAPAKV
TLVGYSMGARIALFMALKFGTKIKGVILISGSPGLNDKLSRKIRAAKDDSRACTFITHGL
QLFVSSWYAGELWKSLRSHPHSNRIIASRLQHDDVQSLAQMLSGLSIGRHLSMWEDLPNC
RVPLVIIHGEKDTKFRNIAQKMMKALCSGLGSKHENGNAIHEVVEIPNSGHAAHLENPLA
IIAAIARFLTRL
NT seq 5079 nt NT seq  +upstreamnt  +downstreamnt
atgattttggcggtgtcgccgttgggaagatggagagtttgcaacagccaaatgtttacg
cttcagactgctgctaataatttcggaatcggaatgccaaccgccaacgccgccactcgc
acccggagtcaggctaccggagtctccggagtgaggtttgatggaccggtgcctctaaac
ggcgacgttctggagaaggaagtgctcttcgagcagtgcgtgacgcggactctctctccg
gcgttgacattggaggaaggactcgagaaattgaaggacgcactccacacgttgaagttg
cagaggcctccttcctctactggattcctccgatttcagctcgccgtccctcccagttcc
aaggccttctctctcttctgctctcaacctctctcctcctccgttttccctctcgtttac
ctctccaagaccaacgccgattctaagtcgctctacgtcaatggaactcgcggcgtttgt
gccgtcggtgccgctgtttcatttctccctccaacctcagaccaccgcactttcgtcaat
agatatgtgtcttctgattccgccaatgtaatggcctatggttttatggatgttaatttg
gatgatggtaatgtgagtcaccaggaaggttctttttggtttttcatccctcagattgag
ttggatgagctggaaagtgtttccattctgtcaatgacgctagcatgggatgacttttct
cactctacttttcaagaagcctattatttgcttgaaatttctctagaccaggttatgtgt
catgtctggtctactattgacaaatggaaatccaaatgcattagaggtgctctcagaaaa
ctcaatttggttgaagatagatctattccaagggtctacatgaacactattgcacctgga
ggaagagaatgtctgagtgacatcatggaactgaaagagtctccatcttcaagtcaattt
tgttttaggctatccgcaacccttgctgtttcaaataatatgttggatcatgccaatgaa
ttgccgtactcactgaaagaaagtgccaatattaatgctgtttgggcatcacttattgtt
gaagaatgcacaagactcggtttgatgtatttctgtattgctcctggttctagatcttcc
cctcttgctgttgctgctgcaagtcacaaattggtcacttgtatttcatgcttcgatgaa
cgttcacttgcatttcatgctgttggatatggaagaggatctcacattccagcagtagtc
ataacatcatcaggcacagcagtttctaaccttcttccggctgttgtggaggcaagtcaa
gattttgtgccacttgttttgcttactgcagatcgacctccagagcttttggattgtgga
gcaaaccaagcaattgatcaggtgaaccattttggttcttttgtgagatttttctttaat
ctccctgcacccacagatcaaattcctgcaaagatggtacttaccactcttgattccgct
atacatcgggcaacttcttcaccatgtggtccagtgcatatcaactgctcttttagagag
cctttggaaagcagtccctgcaaatggttgtctagctgtttaacagggttagatttctgg
atgactaatgctgaaccatttaccaagtatcttcatatgcgattgtctcatactagtagt
tcaaatgctcctggtgaaatgtctgaagtcttggatctgattcaaagatccaagaatagt
cttctattatttggtgcaatccacacagaagatgagatgtgggctgctctgcttttggct
aaacaccttcagtggcctgttgtagcagatatcttgtcagggttgcggttgagaacgctt
ttatgttcttttcctgatattgaaagaaactttatgtttgttgataatcttgatcatgtt
cttctctcagatactgtcaagggctggttagacgttgatgtggttattcagataggaagc
aggttaactagcaaaagagtctgccaaattcttgaggatcgtgctcctttttcatatatt
atggttgacacacatcctcatcgtcatgatccatcacatattataactcaccgtctacaa
acttcaatttttgaatttgtgggctgcttacttaaagcttcagtttcacatactaggagc
atgtggagcatttccctacaattgttgagtaaaatggttgaatgggagataaaatttcaa
attactgcagaatgctcccttactgaaccttatgttgctcatgtgatgtcagaagctctt
acctccgagtctgctctatttcttggtaacagtatgcctatccgggatgcaaatttatat
gggcgcagttggtctatgtgcaatcaaagtgtttcatcaataatgttaaactcagaccta
ccaattaacttggtgagggtggctgctaacaggggtgctagtggtatagatgggttactt
agtacagccattggttttgctgaaggatgcaacaaaaaggtgttatgtgtagttggagat
atttctttattgcatgatacaaatggcctggcaattttgaaccagcggaaatttcggaaa
ccgatgacaattcttgtggttaataatcatggaggagcaattttcagtaatcttcctttg
gccgataaagttgaaacaagcataatgcatgaatacttctacacctctcacaacatttca
atacgtgaactatgcatggcacatggcatcaaacatttacatgtgacgacaaaggaagaa
cttaaagaagctttgtgtgtaggtcagcatgagcaaacagactgtatgattgaaattgag
agttccattgatgccaatgccagtttccacagcattttgaaaaaattcgcactccaaact
gctcaagacaccatgagttatctctcatgggtttttaatgaaggctctgtacatgatgag
ttttgtttatacaaaattcgcaaaatacaatgttctaaatacaggattgcgcttgaagct
ccaccaacatcagcatttgtgggtaatagcaaagaattatataaagaaggatttattctt
tctttagagcttgaagatggaagtgttggttatggtgaggttgcaccaattcacatccac
agggaaaatctggtagatgccgaatatcaacttaggtttcttatccatgttatggaacat
gttgatgttagttgcttcctctctctattgaagggttcattttcatattggatatggcat
gagttgggcatcatgccatcttcaatttttccaagtgttagatgtggtttggaaatggct
atcctcaatgccattgctgatgcaaaaggctccaacatgctgaacgtactccatccctca
ataaatgagaacaacaaatgtgaaaggtcattaaatgttcagatttgtgcattgattgat
tcaaatggatctccagctgaagttgctaatgtggccgccaaactaattgaggaaggattt
tctgcaattaagctgaaggttgctcgcaggggtgatccaatgcttgatgcagcaataata
caagaagtgagaaagaaagtgggttgccagattattatccgtgcagatgctaatcgaaac
tggacttatgaagaagctatgaaattcagctctttggttaaggattgcaacctacagtat
attgaggagcctgttcaggatgaagataatattctcaagttttgtgaagaaagtggctta
tctattgccctagatgaaaccatagatagcatgcaagaaaatcccatggaaaagctagtg
aagtttactcatccagcaatatctgctgttgttattaaaccaagtgttgttggtggattt
gagaatgcagcattaattgctcaatgggcctaccatatggggaagatggttgttgtaagt
tctgcatttgaaagcagtcttagtctttctgcatatactcagttttctagttatcttgaa
atactgagtttaggtaaactcaaagtgttagataatgtgccagcacctactatagcacat
ggtcttggaacctaccgttggcttaaggaagatgtaacaccaaatcctctatctatttgt
cgtaatccacaaagtggttttgttgaagcgtctgtggcaagtgctagtcgatatgtacgt
gattttcaagtcgacaagaaagttgtctcatatgttattgttcaggagcaagttcgtcgg
taccaatgtagagtagagcttaacaatgtatcttgttcttttgaagttcgtgagactggc
catatagcaaatgataacgtgctggtatttcttcatggatttcttggaactggtgaagac
tggattaatatcatgaagaccttttctggatcagcaaagtgcatttctgttgaccttcct
ggtcatggaaaatcaatactacatggcttagagggtgttggtgaggagccatggctgtcg
ctggagacaattgctgatatattgcataaattaattcaccacatagctccagcaaaggtt
acactagtcgggtattcaatgggcgccaggattgcattgtttatggctctcaaatttggc
accaagataaagggtgtcatattaatatctggaagccctggattaaatgataaattatca
agaaaaattcgtgcggctaaagatgattctagagcatgcacattcattacacatggctta
caactttttgtcagttcctggtatgctggagagctgtggaaaagcttaagaagtcatccc
cactccaatcgaatcattgctagtcgcttgcagcatgatgatgtgcagagtcttgcacaa
atgttgtctggattaagcataggaaggcatctgtcaatgtgggaagatttgccaaattgt
agagtacctcttgttatcattcatggagaaaaggatacaaaatttagaaatattgctcag
aaaatgatgaaagcattgtgttctggcttggggagtaagcatgaaaatgggaatgctata
cacgaggttgttgagattcccaactctggccatgctgctcatttggagaatcctctggct
atcattgctgccatagcacgattcctcacaagactgtga

DBGET integrated database retrieval system