KEGG   Phaseolus vulgaris (common bean): PHAVU_005G048300gHelp
Entry
PHAVU_005G048300g CDS       T03093                                 

Definition
(RefSeq) hypothetical protein
  KO
K17761  succinate-semialdehyde dehydrogenase, mitochondrial [EC:1.2.1.24]
Organism
pvu  Phaseolus vulgaris (common bean)
Pathway
pvu00250  Alanine, aspartate and glutamate metabolism
pvu00650  Butanoate metabolism
pvu01100  Metabolic pathways
Module
pvu_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:pvu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    PHAVU_005G048300g
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PHAVU_005G048300g
Enzymes [BR:pvu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.24  succinate-semialdehyde dehydrogenase (NAD+)
     PHAVU_005G048300g
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 18630096
NCBI-ProteinID: XP_007149181
UniProt: V7BVW3
Position
5
AA seq 211 aa AA seqDB search
MAAQNLCFMAMRSSKLLSRPSYLLSVQMQMLSSSPPLTRKMSIDAQSVASKLTSSGLLRT
QGLIGGKWTDAYDGKTIKVYNPATGESIVDVACMGGRETNDAISAAYEAYRSWSKTTAAE
RSKFLRKWYDLLMVHKEELAQLITLEQGKTLKESIGEINYGAGFVEFSAEEAKRVYGDII
PAPLSDRRLFVLKQVTWCLKFFIQLLLYIKQ
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggcagcacagaacctttgcttcatggcaatgcgatcgtcaaagcttctctctcgccct
tcctatcttctctctgttcagatgcagatgctatcctcttctcctcccctcacccggaag
atgagcatagatgcacaaagtgttgcttccaagcttacaagttctggactgctgaggact
cagggccttattggagggaaatggactgacgcttatgatggaaaaaccataaaggtttat
aatccagcaactggtgaatctattgtagatgttgcgtgcatgggtggaagagagacaaat
gatgcaatttctgcagcctatgaagcatatcgatcatggagcaaaaccactgctgctgaa
agaagcaaatttttgaggaaatggtatgatttgctaatggtacataaagaagaacttgca
caacttataaccttggagcaggggaaaactcttaaagagtctattggtgagataaactac
ggggctggatttgttgagttttcagctgaggaggcaaaacgtgtatatggggatataatt
cctgcacctttatccgatcggcgattatttgttcttaagcaggtaacttggtgtcttaaa
ttttttattcagcttttattatacattaaacaatag

DBGET integrated database retrieval system