KEGG   Phaseolus vulgaris (common bean): PHAVU_006G048800gHelp
Entry
PHAVU_006G048800g CDS       T03093                                 

Definition
(RefSeq) hypothetical protein
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
pvu  Phaseolus vulgaris (common bean)
Pathway
pvu00010  Glycolysis / Gluconeogenesis
pvu00562  Inositol phosphate metabolism
pvu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pvu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PHAVU_006G048800g
   00562 Inositol phosphate metabolism
    PHAVU_006G048800g
Enzymes [BR:pvu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     PHAVU_006G048800g
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     PHAVU_006G048800g
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 18627810
NCBI-ProteinID: XP_007146533
UniProt: V7BKN5
Position
6
AA seq 493 aa AA seqDB search
MNNSIMAFVLLLFLLLIRYSNAEEGAFDVRKHLSTVSRYGAVKDIADNNFVPSKLPEGCV
PIHLNLVARHGTRSPTKKRIKELDNLAARLEVLVREAKERSLPLERVPSWLNGWKSPWQG
KRKGGELIIKGEEELYDLGIRIRAKFPDLFDEEYHPDVYPIKASQIPRASASAVAFGMGL
FSGNGSLGPGHHRAFAVTSESRASDLQLRFHDCCHNYKAYRKSQEPAVSKLKEPILDEIT
SALIGRHGLNFTSQDTSSLWFLCKQEASLLDITNQACSLFIPTEIELLEWTDDLEMFILK
GYGKSVNYRMGVPLLEDVFQSMEQAIMAKEERHASGSFEKARLRFAHAETIVPFSCLLGL
FLEGSEIKKIQKEQPLQQPPMPPQKRKWRGSTVAPFAGNNMLVLYRCPAPDRSISKHFVQ
VLHNEHPIPMPGCDGSDFCPFELFKEKIVAPHQKHDYRSVCNPKLELEPSGSKFSQIFQW
LFSPAKGLLSVLD
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaacaattctattatggcctttgttctgctattgttccttttgttgatacggtattca
aacgccgaagaaggagctttcgatgttcgcaaacacctctccactgtctccagatatggt
gccgtgaaagacattgctgacaataacttcgttccttctaaactcccggagggatgtgtt
ccgatccatttgaatcttgtggcaaggcatggaactcgatctcccacgaagaaaaggata
aaggagttagataatttggctgctcgtctggaagttcttgtgagggaagcaaaagagcga
agtttgcctttggagagggttccttcgtggctaaatggatggaaatctccttggcaggga
aagcgtaagggtggtgaattaattatcaaaggagaggaagaattatatgatcttggaatc
aggattagagccaagtttccagatttgtttgatgaagaataccatcctgacgtatatcct
attaaggcatctcagattccccgagcatctgccagtgctgtggcatttggtatggggctt
ttcagtggcaatggaagtcttggacctgggcatcatcgagcctttgctgtgacaagtgaa
agccgtgctagtgatctccagttgagatttcatgactgctgtcataattacaaggcttat
cggaaaagtcaggaacctgcagttagtaaacttaaggaacccatcttggatgagattaca
tctgcattgattgggcgccatggacttaattttactagccaggatacatcttctctctgg
tttttgtgtaaacaggaagcatccttgttagatataactaatcaagcgtgtagtcttttc
atccctactgagattgaattgctggagtggacagatgatttggagatgtttattctgaag
ggttatggtaaatcagtaaactatagaatgggagttccattacttgaagatgtttttcaa
tccatggaacaggctatcatggctaaagaagaaagacatgcttctggcagctttgaaaag
gcaagacttcggtttgcgcatgctgaaactatagttccattctcatgtctccttggttta
tttcttgaaggatctgagattaaaaaaattcagaaggaacaacctctacagcagccccca
atgcctccacagaaaagaaaatggcggggtagcactgtagccccttttgctggcaacaac
atgctggtcttgtatagatgtcctgctccagatagatctataagcaagcactttgtgcag
gtgttacacaatgaacaccccattccaatgccaggttgtgatggctctgatttctgtcca
tttgaactattcaaggaaaaaatagttgcacctcatcagaagcatgactaccgttcggtc
tgtaatccaaagctagagctggagccctcgggcagcaagttttcccagatatttcagtgg
cttttctcaccagcgaaaggtttactctcggtactcgactga

DBGET integrated database retrieval system